PCNT

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PCNT
Ідентифікатори
Символи PCNT, KEN, MOPD2, PCN, PCNT2, PCNTB, PCTN2, SCKL4, pericentrin
Зовнішні ІД HomoloGene: 86942 GeneCards: PCNT
Шаблон експресії
PBB GE PCNT 203660 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006031
NM_001315529
RefSeq (білок)
NP_001302458
NP_006022
н/д
Локус (UCSC) Хр. 21: 46.32 – 46.45 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PCNT (англ. Pericentrin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 3 336 амінокислот, а молекулярна маса — 378 037[4].

Послідовність амінокислот
1020304050
MEVEQEQRRRKVEAGRTKLAHFRQRKTKGDSSHSEKKTAKRKGSAVDASV
QEESPVTKEDSALCGGGDICKSTSCDDTPDGAGGAFAAQPEDCDGEKRED
LEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSD
HPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTI
SDHPAEQRGMFTKECEQECELAITDLESGREDEAGLHQSQAVHGLELEAL
RLSLSNMHTAQLELTQANLQKEKETALTELREMLNSRRAQELALLQSRQQ
HELELLREQHAREKEEVVLRCGQEAAELKEKLQSEMEKNAQIVKTLKEDW
ESEKDLCLENLRKELSAKHQSEMEDLQNQFQKELAEQRAELEKIFQDKNQ
AERALRNLESHHQAAIEKLREDLQSEHGRCLEDLEFKFKESEKEKQLELE
NLQASYEDLKAQSQEEIRRLWSQLDSARTSRQELSELHEQLLARTSRVED
LEQLKQREKTQHESELEQLRIYFEKKLRDAEKTYQEDLTLLQQRLQGARE
DALLDSVEVGLSCVGLEEKPEKGRKDHVDELEPERHKESLPRFQAELEES
HRHQLEALESPLCIQHEGHVSDRCCVETSALGHEWRLEPSEGHSQELPWV
HLQGVQDGDLEADTERAARVLGLETEHKVQLSLLQTELKEEIELLKIENR
NLYGKLQHETRLKDDLEKVKHNLIEDHQKELNNAKQKTELMKQEFQRKET
DWKVMKEELQREAEEKLTLMLLELREKAESEKQTIINKFELREAEMRQLQ
DQQAAQILDLERSLTEQQGRLQQLEQDLTSDDALHCSQCGREPPTAQDGE
LAALHVKEDCALQLMLARSRFLEERKEITEKFSAEQDAFLQEAQEQHARE
LQLLQERHQQQLLSVTAELEARHQAALGELTASLESKQGALLAARVAELQ
TKHAADLGALETRHLSSLDSLESCYLSEFQTIREEHRQALELLRADFEEQ
LWKKDSLHQTILTQELEKLKRKHEGELQSVRDHLRTEVSTELAGTVAHEL
QGVHQGEFGSEKKTALHEKEETLRLQSAQAQPFHQEEKESLSLQLQKKNH
QVQQLKDQVLSLSHEIEECRSELEVLQQRRERENREGANLLSMLKADVNL
SHSERGALQDALRRLLGLFGETLRAAVTLRSRIGERVGLCLDDAGAGLAL
STAPALEETWSDVALPELDRTLSECAEMSSVAEISSHMRESFLMSPESVR
ECEQPIRRVFQSLSLAVDGLMEMALDSSRQLEEARQIHSRFEKEFSFKNE
ETAQVVRKHQELLECLKEESAAKAELALELHKTQGTLEGFKVETADLKEV
LAGKEDSEHRLVLELESLRRQLQQAAQEQAALREECTRLWSRGEATATDA
EAREAALRKEVEDLTKEQSETRKQAEKDRSALLSQMKILESELEEQLSQH
RGCAKQAEAVTALEQQVASLDKHLRNQRQFMDEQAAEREHEREEFQQEIQ
RLEGQLRQAAKPQPWGPRDSQQAPLDGEVELLQQKLREKLDEFNELAIQK
ESADRQVLMQEEEIKRLEEMNINIRKKVAQLQEEVEKQKNIVKGLEQDKE
VLKKQQMSSLLLASTLQSTLDAGRCPEPPSGSPPEGPEIQLEVTQRALLR
RESEVLDLKEQLEKMKGDLESKNEEILHLNLKLDMQNSQTAVSLRELEEE
NTSLKVIYTRSSEIEELKATIENLQENQKRLQKEKAEEIEQLHEVIEKLQ
HELSLMGPVVHEVSDSQAGSLQSELLCSQAGGPRGQALQGELEAALEAKE
ALSRLLADQERRHSQALEALQQRLQGAEEAAELQLAELERNVALREAEVE
DMASRIQEFEAALKAKEATIAERNLEIDALNQRKAAHSAELEAVLLALAR
IRRALEQQPLAAGAAPPELQWLRAQCARLSRQLQVLHQRFLRCQVELDRR
QARRATAHTRVPGAHPQPRMDGGAKAQVTGDVEASHDAALEPVVPDPQGD
LQPVLVTLKDAPLCKQEGVMSVLTVCQRQLQSELLLVKNEMRLSLEDGGK
GKEKVLEDCQLPKVDLVAQVKQLQEKLNRLLYSMTFQNVDAADTKSLWPM
ASAHLLESSWSDDSCDGEEPDISPHIDTCDANTATGGVTDVIKNQAIDAC
DANTTPGGVTDVIKNWDSLIPDEMPDSPIQEKSECQDMSLSSPTSVLGGS
RHQSHTAEAGPRKSPVGMLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGA
LSLCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAALALQWAESPPADDH
HVQRTAVEKDVEDFITTSFDSQETLSSPPPGLEGKADRSEKSDGSGFGAR
LSPGSGGPEAQTAGPVTPASISGRFQPLPEAMKEKEVRPKHVKALLQMVR
DESHQILALSEGLAPPSGEPHPPRKEDEIQDISLHGGKTQEVPTACPDWR
GDLLQVVQEAFEKEQEMQGVELQPRLSGSDLGGHSSLLERLEKIIREQGD
LQEKSLEHLRLPDRSSLLSEIQALRAQLRMTHLQNQEKLQHLRTALTSAE
ARGSQQEHQLRRQVELLAYKVEQEKCIAGDLQKTLSEEQEKANSVQKLLA
AEQTVVRDLKSDLCESRQKSEQLSRSLCEVQQEVLQLRSMLSSKENELKA
ALQELESEQGKGRALQSQLEEEQLRHLQRESQSAKALEELRASLETQRAQ
SSRLCVALKHEQTAKDNLQKELRIEHSRCEALLAQERSQLSELQKDLAAE
KSRTLELSEALRHERLLTEQLSQRTQEACVHQDTQAHHALLQKLKEEKSR
VVDLQAMLEKVQQQALHSQQQLEAEAQKHCEALRREKEVSATLKSTVEAL
HTQKRELRCSLEREREKPAWLQAELEQSHPRLKEQEGRKAARRSAEARQS
PAAAEQWRKWQRDKEKLRELELQRQRDLHKIKQLQQTVRDLESKDEVPGS
RLHLGSARRAAGSDADHLREQQRELEAMRQRLLSAARLLTSFTSQAVDRT
VNDWTSSNEKAVMSLLHTLEELKSDLSRPTSSQKKMAAELQFQFVDVLLK
DNVSLTKALSTVTQEKLELSRAVSKLEKLLKHHLQKGCSPSRSERSAWKP
DETAPQSSLRRPDPGRLPPAASEEAHTSNVKMEKLYLHYLRAESFRKALI
YQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKAERKITSRPFTRFRTAV
RVVIAILRLRFLVKKWQEVDRKGALAQGKAPRPGPRARQPQSPPRTRESP
PTRDVPSGHTRDPARGRRLAAAASPHSGGRATPSPNSRLERSLTASQDPE
HSLTEYIHHLEVIQQRLGGVLPDSTSKKSCHPMIKQ

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою кальмодуліну. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Flory M.R., Moser M.J., Monnat R.J. Jr., Davis T.N. (2000). Identification of a human centrosomal calmodulin-binding protein that shares homology with pericentrin.. Proc. Natl. Acad. Sci. U.S.A. 97: 5919 — 5923.  PubMed DOI:10.1073/pnas.97.11.5919
  • Matsuo K., Nishimura T., Hayakawa A., Ono Y., Takahashi M. (2010). Involvement of a centrosomal protein kendrin in the maintenance of centrosome cohesion by modulating Nek2A kinase activity.. Biochem. Biophys. Res. Commun. 398: 217 — 223.  PubMed DOI:10.1016/j.bbrc.2010.06.063
  • Lee K., Rhee K. (2012). Separase-dependent cleavage of pericentrin B is necessary and sufficient for centriole disengagement during mitosis.. Cell Cycle 11: 2476 — 2485.  PubMed DOI:10.4161/cc.20878
  • Fang C.T., Kuo H.H., Pan T.S., Yu F.C., Yih L.H. (2016). HSP70 regulates the function of mitotic centrosomes.. Cell. Mol. Life Sci. 73: 3949 — 3960.  PubMed DOI:10.1007/s00018-016-2236-8

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16068 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O95613 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]