DAXX

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DAXX
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DAXX, BING2, DAP6, EAP1, death-domain associated protein, death domain associated protein, SMIM40
Зовнішні ІД OMIM: 603186 MGI: 1197015 HomoloGene: 1033 GeneCards: DAXX
Шаблон експресії
PBB GE DAXX 216038 x at fs.png

PBB GE DAXX 201763 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001141969
NM_001141970
NM_001254717
NM_001350
NM_001199733
NM_007829
NM_001355704
RefSeq (білок)
NP_001135441
NP_001135442
NP_001241646
NP_001341
NP_001186662
NP_031855
NP_001342633
Локус (UCSC) Хр. 6: 33.32 – 33.32 Mb Хр. 17: 33.91 – 33.92 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DAXX (англ. Death domain associated protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 740 амінокислот, а молекулярна маса — 81 373[4].

Послідовність амінокислот
1020304050
MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGS
SSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFL
ASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAAT
TSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVA
EIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTG
RVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARH
SLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDP
ALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQG
TSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEE
EEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSL
QISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGE
QPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTV
LENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVE
RQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCI
PSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD

Кодований геном білок за функціями належить до шаперонів, репресорів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі, хромосомах, центромерах.

Література[ред. | ред. код]

  • Yang X., Khosravi-Far R., Chang H.Y., Baltimore D. (1997). Daxx, a novel Fas-binding protein that activates JNK and apoptosis.. Cell 89: 1067 — 1076.  PubMed DOI:10.1016/S0092-8674(00)80294-9
  • Kiriakidou M., Driscoll D.A., Lopez-Guisa J.M., Strauss J.F. III (1997). Cloning and expression of primate Daxx cDNAs and mapping of the human gene to chromosome 6p21.3 in the MHC region.. DNA Cell Biol. 16: 1289 — 1298.  PubMed DOI:10.1089/dna.1997.16.1289
  • Herberg J.A., Beck S., Trowsdale J. (1998). TAPASIN, DAXX, RGL2, HKE2 and four new genes (BING 1, 3 to 5) form a dense cluster at the centromeric end of the MHC.. J. Mol. Biol. 277: 839 — 857.  PubMed DOI:10.1006/jmbi.1998.1637
  • Li R., Pei H., Watson D.K., Papas T.S. (2000). EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes.. Oncogene 19: 745 — 753.  PubMed DOI:10.1038/sj.onc.1203385
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hollenbach A.D., Sublett J.E., McPherson C.J., Grosveld G. (1999). The Pax3-FKHR oncoprotein is unresponsive to the Pax3-associated repressor hDaxx.. EMBO J. 18: 3702 — 3711.  PubMed DOI:10.1093/emboj/18.13.3702

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2681 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q9UER7 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]