PKN3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PKN3
Ідентифікатори
Символи PKN3, UTDP4-1, protein kinase N3
Зовнішні ІД MGI: 2388285 HomoloGene: 50980 GeneCards: PKN3
Пов'язані генетичні захворювання
Ожиріння[1]
Шаблон експресії
PBB GE PKN3 gnf1h00136 at fs.png

PBB GE PKN3 gnf1h00137 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_013355
NM_001317926
NM_153805
RefSeq (білок)
NP_001304855
NP_037487
NP_722500
Локус (UCSC) Хр. 9: 128.7 – 128.72 Mb Хр. 2: 30.08 – 30.09 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PKN3 (англ. Protein kinase N3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 889 амінокислот, а молекулярна маса — 99 421[5].

Послідовність амінокислот
1020304050
MEEGAPRQPGPSQWPPEDEKEVIRRAIQKELKIKEGVENLRRVATDRRHL
GHVQQLLRSSNRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAE
QLRARHLEALRRQLHVELKVKQGAENMTHTCASGTPKERKLLAAAQQMLR
DSQLKVALLRMKISSLEASGSPEPGPELLAEELQHRLHVEAAVAEGAKNV
VKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLLEQLPPAHPLR
SRVTRELRAAVPGYPQPSGTPVKPTALTGTLQVRLLGCEQLLTAVPGRSP
AAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVA
EQSWDQTFVIPLERARELEIGVHWRDWRQLCGVAFLRLEDFLDNACHQLS
LSLVPQGLLFAQVTFCDPVIERRPRLQRQERIFSKRRGQDFLRASQMNLG
MAAWGRLVMNLLPPCSSPSTISPPKGCPRTPTTLREASDPATPSNFLPKK
TPLGEEMTPPPKPPRLYLPQEPTSEETPRTKRPHMEPRTRRGPSPPASPT
RKPPRLQDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDE
IESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMMQ
IHEDVFPEPQARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKI
ADFGLCKEGIGFGDRTSTFCGTPEFLAPEVLTQEAYTRAVDWWGLGVLLY
EMLVGECPFPGDTEEEVFDCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEK
RLGAGEQDAEEIKVQPFFRTTNWQALLARTIQPPFVPTLCGPADLRYFEG
EFTGLPPALTPPAPHSLLTARQQAAFRDFDFVSERFLEP

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Oishi K., Mukai H., Shibata H., Takahashi M., Ono Y. (1999). Identification and characterization of PKNbeta, a novel isoform of protein kinase PKN: expression and arachidonic acid dependency are different from those of PKNalpha.. Biochem. Biophys. Res. Commun. 261: 808 — 814.  PubMed DOI:10.1006/bbrc.1999.1116
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]