Альфа-1-антитрипсин

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Альфа-1-антитрипсин
A1AT.png
Ідентифікатори
Символи alpha-1-antitrypsin short transcript variant 1C4serpin peptidase inhibitor clade A member 1Serpin family A member 1serpin A1alpha-1 protease inhibitoralpha-1-antitrypsin nullSERPINA1serpin peptidase inhibitor clade A (alpha-1antiproteinaseantitrypsin) member 1epididymis secretory sperm binding proteinserpin peptidase inhibitorclade A (alpha-1 antiproteinaseantitrypsin)member 1alpha-1 antitrypsinalpha-1-antitrypsin short transcript variant 1C5protease inhibitor 1 (anti-elastase)alpha-1-antitrypsinalpha-1-antiproteinaseserine (or cysteine) proteinase inhibitorclade Amember 1alpha-1-antitrypsin
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE SERPINA1 211429 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

SERPINA1 (англ. Serpin family A member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 418 амінокислот, а молекулярна маса — 46 737[2].

Послідовність амінокислот
1020304050
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKI
TPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEI
LEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKL
VDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKEL
DRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGM
FNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFL
ENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP
LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIE
QNTKSPLFMGKVVNPTQK

Кодований геном білок за функціями належить до інгібіторів протеаз, інгібіторів серинових протеаз. Задіяний у таких біологічних процесах як зсідання крові, гемостаз, гостра фаза запалення. Локалізований у позаклітинному матриксі, ендоплазматичному ретикулумі. Також секретований назовні.

Література[ред. | ред. код]

  • Long G.L., Chandra T., Woo S.L.C., Davie E.W., Kurachi K. (1984). Complete sequence of the cDNA for human alpha 1-antitrypsin and the gene for the S variant.. Biochemistry 23: 4828 — 4837.  PubMed DOI:10.1021/bi00316a003
  • Rosenberg S., Barr P.J., Najarian R.C., Hallewell R.A. (1984). Synthesis in yeast of a functional oxidation-resistant mutant of human alpha-antitrypsin.. Nature 312: 77 — 80.  PubMed DOI:10.1038/312077a0
  • Ciliberto G., Dente L., Cortese R. (1985). Cell-specific expression of a transfected human alpha 1-antitrypsin gene.. Cell 41: 531 — 540.  PubMed DOI:10.1016/S0092-8674(85)80026-X
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kolarich D., Weber A., Turecek P.L., Schwarz H.P., Altmann F. (2006). Comprehensive glyco-proteomic analysis of human alpha1-antitrypsin and its charge isoforms.. Proteomics 6: 3369 — 3380.  PubMed DOI:10.1002/pmic.200500751
  • Riley J.H., Bathurst I.C., Edbrooke M.R., Carrell R.W., Craig R.K. (1985). Alpha 1-antitrypsin and serum albumin mRNA accumulation in normal, acute phase and ZZ human liver.. FEBS Lett. 189: 361 — 366.  PubMed DOI:10.1016/0014-5793(85)81056-5

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:8941 (англ.). Процитовано 6 лютого 2017. 
  2. UniProt, P01009 (англ.). Процитовано 6 лютого 2017. 

Див. також[ред. | ред. код]