Тромбін

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Тромбін
Ідентифікатори
Символи prothrombin B-chainCoagulation factor IIF2prepro-coagulation factor IIprothrombinserine proteasethrombin factor II
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Тромбін в комплексі з інгібітором

Тромбін (фактор згортання крові II) — білок, який кодується геном F2, розташованим у людей на короткому плечі 11-ї хромосоми.[1][2] Довжина поліпептидного ланцюга білка становить 622 амінокислот, а молекулярна маса — 70 037[3]. Тромбін - важливий компонент системи згортання крові людини і тварин. Тромбін (КФ 3.4.21.5[4]) відноситься до ферментів класу гідролаз, групи серинових протеаз, та каталізує гідроліз пептидних зв'язків, утворених залишками аргініну і лізину (має обмежену субстратну специфічність).

Послідовність амінокислот
1020304050
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEE
VRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKL
AACLEGNCAEGLGTNYRGHVNITRSGIECQLWRSRYPHKPEINSTTHPGA
DLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTVAMTPRSE
GSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQD
FNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDK
TERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRW
VLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIH
PRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGR
VTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFC
AGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE

Цей білок за функціями належить до гідролаз, протеаз, серинових протеаз. Задіяний у таких біологічних процесах, як зсідання крові, гемостаз, гостра фаза запалення. Білок має сайт для зв'язування з іоном кальцію. Секретований назовні.

Література[ред. | ред. код]

  • Degen S.J.F., Davie E.W. (1987). Nucleotide sequence of the gene for human prothrombin.. Biochemistry 26: 6165 — 6177.  PubMed DOI:10.1021/bi00393a033
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Degen S.J.F., McGillivray R.T.A., Davie E.W. (1983). Characterization of the complementary deoxyribonucleic acid and gene coding for human prothrombin.. Biochemistry 22: 2087 — 2097.  PubMed DOI:10.1021/bi00278a008
  • Walz D.A., Hewett-Emmett D., Seegers W.H. (1977). Amino acid sequence of human prothrombin fragments 1 and 2.. Proc. Natl. Acad. Sci. U.S.A. 74: 1969 — 1972.  PubMed DOI:10.1073/pnas.74.5.1969
  • Casas J.P., Hingorani A.D., Bautista L.E., Sharma P. (2004). Meta-analysis of genetic studies in ischemic stroke: thirty-two genes involving approximately 18,000 cases and 58,000 controls.. Arch. Neurol. 61: 1652 — 1661.  PubMed DOI:10.1001/archneur.61.11.1652
  • Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.. Proteomics 4: 454 — 465.  PubMed DOI:10.1002/pmic.200300556

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:3535 (англ.). Процитовано 5 жовтня 2018. 
  2. Royle NJ, Irwin DM, Koschinsky ML, MacGillivray RT, Hamerton JL (May 1987). Human genes encoding prothrombin and ceruloplasmin map to 11p11-q12 and 3q21-24, respectively. Somat. Cell Mol. Genet. 13 (3): 285–92. PMID 3474786. doi:10.1007/BF01535211. 
  3. UniProt, P00734 (англ.). Процитовано 5 жовтня 2018. 
  4. 3.4.21.5(англ.)

Див. також[ред. | ред. код]