EP300

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
EP300
Protein EP300 PDB 1f81.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EP300, KAT3B, RSTS2, p300, E1A binding protein p300
Зовнішні ІД MGI: 1276116 HomoloGene: 1094 GeneCards: EP300
Реагує на сполуку
Куркумін, Ґаллат епіґаллокатехіну, plumbagin[1]
Шаблон експресії
PBB GE EP300 213579 s at fs.png

PBB GE EP300 202221 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001429
NM_001362843
NM_177821
RefSeq (білок)
NP_001420
NP_001349772
NP_808489
Локус (UCSC) Хр. 22: 41.09 – 41.18 Mb Хр. 15: 81.59 – 81.65 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EP300 (англ. E1A binding protein p300) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 2 414 амінокислот, а молекулярна маса — 264 161[5].

Послідовність амінокислот
1020304050
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINS
TELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGP
GQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQS
TGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGR
GRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNP
NPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMP
NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHK
CQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQII
SHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSA
PNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSP
QGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASV
PSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRT
RLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPN
QMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMG
YGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSS
CPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIG
AQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQ
VSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISES
KVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFK
PEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLS
TIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFE
QEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTEC
GRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGT
FLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMA
ESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDS
VHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHC
HPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKK
KNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRL
IAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWS
TMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKN
HDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRN
ANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSP
TPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGK
AAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQR
PIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGL
PQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQA
LQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQP
QQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPG
IGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALG
AEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIP
NSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPG
LVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNS
DLNSNLSQSTLDIH

Кодований геном білок за функціями належить до трансфераз, ацилтрансфераз, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, клітинний цикл, біологічні ритми, ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Lundblad J.R., Kwok R.P.S., Laurance M.E., Harter M.L., Goodman R.H. (1995). Adenoviral E1A-associated protein p300 as a functional homologue of the transcriptional co-activator CBP.. Nature 374: 85 — 88.  PubMed DOI:10.1038/374085a0
  • Ogryzko V.V., Schiltz R.L., Russanova V., Howard B.H., Nakatani Y. (1996). The transcriptional coactivators p300 and CBP are histone acetyltransferases.. Cell 87: 953 — 959.  PubMed DOI:10.1016/S0092-8674(00)82001-2
  • Yang X.-J., Ogryzko V.V., Nishikawa J., Howard B.H., Nakatani Y. (1996). A p300/CBP-associated factor that competes with the adenoviral oncoprotein E1A.. Nature 382: 319 — 324.  PubMed DOI:10.1038/382319a0
  • Bex F., Yin M.-J., Burny A., Gaynor R.B. (1998). Differential transcriptional activation by human T-cell leukemia virus type 1 Tax mutants is mediated by distinct interactions with CREB binding protein and p300.. Mol. Cell. Biol. 18: 2392 — 2405.  PubMed DOI:10.1128/MCB.18.4.2392
  • Fryer C.J., Archer T.K. (1998). Chromatin remodelling by the glucocorticoid receptor requires the BRG1 complex.. Nature 393: 88 — 91.  PubMed DOI:10.1038/30032
  • Lau P., Bailey P., Dowhan D.H., Muscat G.E. (1999). Exogenous expression of a dominant negative RORalpha1 vector in muscle cells impairs differentiation: RORalpha1 directly interacts with p300 and myoD.. Nucleic Acids Res. 27: 411 — 420.  PubMed DOI:10.1093/nar/27.2.411

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]