MAP3K7

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MAP3K7
Protein MAP3K7 PDB 2eva.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MAP3K7, MEKK7, TAK1, TGF1a, mitogen-activated protein kinase kinase kinase 7, FMD2, CSCF
Зовнішні ІД OMIM: 602614 HomoloGene: 135715 GeneCards: MAP3K7
Шаблон експресії
PBB GE MAP3K7 206854 s at fs.png

PBB GE MAP3K7 206853 s at fs.png

PBB GE MAP3K7 211536 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003188
NM_145331
NM_145332
NM_145333
NM_001107920
RefSeq (білок)
NP_003179
NP_663304
NP_663305
NP_663306
NP_001101390
Локус (UCSC) Хр. 6: 90.51 – 90.59 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MAP3K7 (англ. Mitogen-activated protein kinase kinase kinase 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 606 амінокислот, а молекулярна маса — 67 196[4].

Послідовність амінокислот
1020304050
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVV
CKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPV
CLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPK
ALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEV
FEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPP
LIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLES
KLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIA
ATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEP
GQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAY
LTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQEL
VAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, відповідь на стрес, транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, іонами металів, іоном магнію. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література[ред. | ред. код]

  • Sakurai H., Shigemori N., Hasegawa K., Sugita T. (1998). TGF-beta-activated kinase 1 stimulates NF-kappa B activation by an NF-kappa B-inducing kinase-independent mechanism.. Biochem. Biophys. Res. Commun. 243: 545 — 549.  PubMed DOI:10.1006/bbrc.1998.8124
  • Dempsey C.E., Sakurai H., Sugita T., Guesdon F. (2000). Alternative splicing and gene structure of the transforming growth factor beta-activated kinase 1.. Biochim. Biophys. Acta 1517: 46 — 52.  PubMed DOI:10.1016/S0167-4781(00)00258-X
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sakurai H., Miyoshi H., Mizukami J., Sugita T. (2000). Phosphorylation-dependent activation of TAK1 mitogen-activated protein kinase kinase kinase by TAB1.. FEBS Lett. 474: 141 — 145.  PubMed DOI:10.1016/S0014-5793(00)01588-X
  • Kishimoto K., Matsumoto K., Ninomiya-Tsuji J. (2000). TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop.. J. Biol. Chem. 275: 7359 — 7364.  PubMed DOI:10.1074/jbc.275.10.7359
  • Jiang Z., Ninomiya-Tsuji J., Qian Y., Matsumoto K., Li X. (2002). Interleukin-1 (IL-1) receptor-associated kinase-dependent IL-1-induced signaling complexes phosphorylate TAK1 and TAB2 at the plasma membrane and activate TAK1 in the cytosol.. Mol. Cell. Biol. 22: 7158 — 7167.  PubMed DOI:10.1128/MCB.22.20.7158-7167.2002

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6859 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, O43318 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]