OR8D4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
OR8D4
Ідентифікатори
Символи OR8D4, OR11-275, olfactory receptor family 8 subfamily D member 4
Зовнішні ІД MGI: 3030819 HomoloGene: 17416 GeneCards: OR8D4
Шаблон експресії
PBB GE OR8D4 gnf1h05555 at fs.png

PBB GE OR8D4 gnf1h05556 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001005197
NM_146855
RefSeq (білок)
NP_001005197
NP_667066
Локус (UCSC) Хр. 11: 123.9 – 123.91 Mb Хр. 9: 40.13 – 40.13 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR8D4 (англ. Olfactory receptor family 8 subfamily D member 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 314 амінокислот, а молекулярна маса — 35 019[4].

Послідовність амінокислот
1020304050
MGVKNHSTVTEFLLSGLTEQAELQLPLFCLFLGIYTVTVVGNLSMISIIR
LNRQLHTPMYYFLSSLSFLDFCYSSVITPKMLSGFLCRDRSISYSGCMIQ
LFFFCVCVISECYMLAAMACDRYVAICSPLLYRVIMSPRVCSLLVAAVFS
VGFTDAVIHGGCILRLSFCGSNIIKHYFCDIVPLIKLSCSSTYIDELLIF
VIGGFNMVATSLTIIISYAFILTSILRIHSKKGRCKAFSTCSSHLTAVLM
FYGSLMSMYLKPASSSSLTQEKVSSVFYTTVILMLNPLIYSLRNNEVRNA
LMKLLRRKISLSPG

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family.. Proc. Natl. Acad. Sci. U.S.A. 101: 2584 — 2589.  PubMed DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205 — 7205. 

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:14840 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q8NGM9 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]