OR2D2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
OR2D2
Ідентифікатори
Символи OR2D2, OR11-610, OR2D1, hg27, olfactory receptor family 2 subfamily D member 2
Зовнішні ІД OMIM: 608494 MGI: 3647188 HomoloGene: 81541 GeneCards: OR2D2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003700
NM_001162940
RefSeq (білок)
NP_003691
NP_001156412
Локус (UCSC) Хр. 11: 6.89 – 6.89 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR2D2 (англ. Olfactory receptor family 2 subfamily D member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 308 амінокислот, а молекулярна маса — 34 172[4].

Послідовність амінокислот
1020304050
MRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGNLLLISLVH
VDSQLHTPMYFFLCNLSLADLCFSTNIVPQALVHLLSRKKVIAFTLCAAR
LLFFLIFGCTQCALLAVMSYDRYVAICNPLRYPNIMTWKVCVQLATGSWT
SGILVSVVDTTFILRLPYRGSNSIAHFFCEAPALLILASTDTHASEMAIF
LMGVVILLIPVFLILVSYGRIIVTVVKMKSTVGSLKAFSTCGSHLMVVIL
FYGSAIITYMTPKSSKQQEKSVSVFYAIVTPMLNPLIYSLRNKDVKAALR
KVATRNFP

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family.. Proc. Natl. Acad. Sci. U.S.A. 101: 2584 — 2589.  PubMed DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205 — 7205. 

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8244 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q9H210 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]