Ангіотензинперетворювальний фермент 2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ACE2
Protein ACE2 PDB 1r42.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ACE2, ACEH, angiotensin I converting enzyme 2, ACE 2
Зовнішні ІД OMIM: 300335 MGI: 1917258 HomoloGene: 41448 GeneCards: ACE2
Шаблон експресії
PBB GE ACE2 219962 at fs.png

PBB GE ACE2 222257 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021804
NM_001371415
NM_001130513
NM_027286
RefSeq (білок)
NP_068576
NP_001358344
NP_001123985
NP_081562
Локус (UCSC) Хр. X: 15.56 – 15.6 Mb Хр. X: 162.92 – 162.97 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Ангіотензинперетворюючий фермент 2 (англ. Angiotensin I converting enzyme 2, ACE2) – білок, який кодується геном ACE2, розташованим у людини на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 805 амінокислот, а молекулярна маса — 92 463[4]. Це мембранний або секретований фермент-протеаза, який належить до карбоксипептидаз і металопротеаз. Його основною функцією є розщеплення пептидного гормону ангіотензину I до більш активної форми ангіотензину II. ACE2 руйнує пептид брадикінін і є його природним регулятором в організмі людини[5]. Також цей білок є рецептором для входу в клітину низки вірусів, зокрема коронавірусів SARS-CoV і SARS-CoV-2.

Послідовність амінокислот
1020304050
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNY
NTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQAL
QQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNE
IMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYG
DYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMN
AYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWD
LGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGF
HEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTL
PFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDP
ASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEA
GQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYA
MRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEV
EKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVM
GVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDD
VQTSF

Структура і локалізація[ред. | ред. код]

Білок має сайти для зв'язування з іоном цинку та хлоридом.

Локалізований у клітинній мембрані, цитоплазмі, а також секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lin Q., Keller R.S., Weaver B., Zisman L.S. (2004). Interaction of ACE2 and integrin beta1 in failing human heart.. Biochim. Biophys. Acta 1689: 175 — 178.  PubMed DOI:10.1016/j.bbadis.2004.05.005
  • Harmer D., Gilbert M., Borman R., Clark K.L. (2002). Quantitative mRNA expression profiling of ACE 2, a novel homologue of angiotensin converting enzyme.. FEBS Lett. 532: 107 — 110.  PubMed DOI:10.1016/S0014-5793(02)03640-2
  • Goulter A.B., Goddard M.J., Allen J.C., Clark K.L. (2004). ACE2 gene expression is up-regulated in the human failing heart.. BMC Med. 2: 19 — 19.  PubMed DOI:10.1186/1741-7015-2-19
  • Lai Z.W., Hanchapola I., Steer D.L., Smith A.I. (2011). Angiotensin-converting enzyme 2 ectodomain shedding cleavage-site identification: determinants and constraints.. Biochemistry 50: 5182 — 5194.  PubMed DOI:10.1021/bi200525y

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13557 (англ.). Архів оригіналу за 10 вересня 2015. Процитовано 12 вересня 2017. 
  4. UniProt, Q9BYF1 (англ.). Архів оригіналу за 29 серпня 2017. Процитовано 12 вересня 2017. 
  5. van de Veerdonk, F.; Netea, M.G.; van Deuren, M.; van der Meer, J.W.; de Mast, Q.; Bruggemann, R.J.; van der Hoeven, H. Kinins and Cytokines in COVID-19: A Comprehensive Pathophysiological Approach. Preprints 2020, 2020040023 (doi: 10.20944/preprints202004.0023.v1).[1] [Архівовано 8 квітня 2020 у Wayback Machine.](англ.)

Див. також[ред. | ред. код]