Ангіотензинперетворювальний фермент

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Ангіотензинперетворювальний фермент
Ідентифікатори
Символи angiotensin converting enzymesomatic isoformCD143 antigencarboxycathepsindipeptidyl carboxypeptidase Idipeptidyl carboxypeptidase 1peptidase PACEangiotensin-converting enzymekininase IIangiotensin I converting enzyme (peptidyl-dipeptidase A) 1
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

Ангіотензинперетворювальний фермент, також ангіотензинперетворювальний фактор (АПФ, англ. Angiotensin I converting enzyme) – білок, який кодується геном ACE, розташованим у людини на короткому плечі 17-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 1 306 амінокислот, а молекулярна маса — 149 715[2].

Послідовність амінокислот
1020304050
MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFA
QSYNSSAEQVLFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQK
AKELYEPIWQNFTDPQLRRIIGAVRTLGSANLPLAKRQQYNALLSNMSRI
YSTAKVCLPNKTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPL
KPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQLEPL
YLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF
PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEK
PADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQ
YKDLPVSLRRGANPGFHEAIGDVLALSVSTPEHLHKIGLLDRVTNDTESD
INYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQ
GICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGY
EGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL
KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEAS
KFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKY
GTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETT
YSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQ
FYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYL
NLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPT
DGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYK
DLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDIN
FLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGL
CPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTG
PLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY
FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDL
DAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSE
VELRHS

Кодований геном білок за функціями належить до металопротеаз та карбоксипептидаз. Білок має сайт для зв'язування з іоном цинку. Локалізований у клітинній мембрані, цитоплазмі, а також секретований назовні.

Фізіологічна функція[ред. | ред. код]

АПФ є важливим елементом ренін-ангіотензинової системи - важливого регулятора артеріального тиску в кровоносній судині ссавців, зокрема людини.

Внаслідок зменшення артеріального тиску крові у юкстагломерулярних клітинах, які є частиною нефрону в нирках, починає виділятися гормоноподібний протеолітичний фермент ренін. Під дією реніну з білка α2-глобулінової фракції крові — ангіотензиногену, шляхом обмеженого протеолізу відщеплюється декапептид ангіотензин І. Від цього пептиду під дією АПФ відщеплюється 2 амінокислотних залишки й утворюється ангіотензин ІІ. Ангіотензин ІІ у свою чергу проявляє вазокнстрикторну дію та стимулює виділення корою наднирників альдостерону, під дією якого збільшується реабсорбція іонів натрію та води у дистальному відділі нефрона, що призводить до збільшення об'єму циркулюючої крові.

Також АПФ розщеплює пептидний гормон брадикінін, елемент калікреїн-кінінової системи, таким чином ще зменшуючи розслаблювальну дію на м'язи судин.

У медицині[ред. | ред. код]

Для лікування артеріальної гіпертензії в клінічній практиці використовуються інгібітори АПФ, зокрема беназеприл, каптоприл, цилазаприл, еналаприл, фозиноприл, лізиноприл тощо.

Література[ред. | ред. код]

  • Ehlers M.R.W., Fox E.A., Strydom D.J., Riordan J.F. (1989). Molecular cloning of human testicular angiotensin-converting enzyme: the testis isozyme is identical to the C-terminal half of endothelial angiotensin-converting enzyme.. Proc. Natl. Acad. Sci. U.S.A. 86: 7741 — 7745.  PubMed DOI:10.1073/pnas.86.20.7741
  • Rieder M.J., Taylor S.L., Clark A.G., Nickerson D.A. (1999). Sequence variation in the human angiotensin converting enzyme.. Nat. Genet. 22: 59 — 62.  PubMed DOI:10.1038/8760
  • Sugimura K., Tian X.-L., Hoffmann S., Ganten D., Bader M. (1998). Alternative splicing of the mRNA coding for the human endothelial angiotensin-converting enzyme: a new mechanism for solubilization.. Biochem. Biophys. Res. Commun. 247: 466 — 472.  PubMed DOI:10.1006/bbrc.1998.8813
  • Ehlers M.R.W., Riordan J.F. (1991). Angiotensin-converting enzyme: zinc- and inhibitor-binding stoichiometries of the somatic and testis isozymes.. Biochemistry 30: 7118 — 7126.  PubMed DOI:10.1021/bi00243a012
  • Sturrock E.D., Yu X.C., Wu Z., Biemann K., Riordan J.F. (1996). Assignment of free and disulfide-bonded cysteine residues in testis angiotensin-converting enzyme: functional implications.. Biochemistry 35: 9560 — 9566.  PubMed DOI:10.1021/bi960243x
  • Kohlstedt K., Shoghi F., Mueller-Esterl W., Busse R., Fleming I. (2002). CK2 phosphorylates the angiotensin-converting enzyme and regulates its retention in the endothelial cell plasma membrane.. Circ. Res. 91: 749 — 756.  PubMed DOI:10.1161/01.RES.0000038114.17939.C8

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:2707 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P12821 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]