Лізоцим

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Лізоцим
Ідентифікатори
Символи Glyco_hydro_22_lysIPR000974lysozymeLysozyme1,4-N-AcetylmuramidaseDelvozymeGlobulin G1Lydium-KLPMucopeptide glucohydrolaseMuramidaseN,O-DiacetylmuramidasePeptidoglycan N-acetylmuramoylhydrolasemucopeptide N-acetylmuramoylhydrolase
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

Лізоцим (англ. Lysozyme), мурамідаза або N-ацетилмурамідклікангідролаза (КФ 3.2.1.17) — білок, який кодується геном LYZ, розташованим у людини на довгому плечі 12-ї хромосоми.[1][2][3] Довжина поліпептидного ланцюга білка становить 148 амінокислот, а молекулярна маса — 16 537[4].

Послідовність амінокислот
1020304050
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLA
KWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
ALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV

Цей білок є ферментом, що руйнує клітинну стінку бактерій шляхом каталізу реакції гідролізу 1,4-бета-зв'язків між залишками N-ацетилмурамової кислоти і N-ацетил-D-глюкозаміном у складі гліканового ланцюжка пептидоглікану та між залишками N-ацетил-D-глюкозаміну в складі хітодекстрину. Лізоцим у великій кількості міститься в багатьох секретах тварин, таких як сльози, слина і слиз. Лізоцим також міститься у цитоплазмених гранулах поліморфоядерних нейтрофілів. У великій кількості цей фермент також присутній у білках яєць. Лізоцими C-типу близько пов'язані з альфа-лактальбуміном як за нуклеотидною послідовністю генів, так і за своєю структурою, що робить їх членами однієї родини.

Лізоцим відкрив 1921 року Александер Флемінг (першовідкривач пеніциліну). Він помістив на тверде агаризоване середовище трохи слизу із носа, а через кілька тижнів помітив, що ріст бактерій навколо слизу був пригнічений. Пізніше вчений виділив саму антибактерійну речовину — лізоцим[5].

Література[ред. | ред. код]

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:6740 (англ.). Архів оригіналу за 26 січня 2017. Процитовано 30 листопада 2018. 
  2. Yoshimura K, Toibana A, Nakahama K (January 1988). Human lysozyme: sequencing of a cDNA, and expression and secretion by Saccharomyces cerevisiae. Biochem. Biophys. Res. Commun. 150 (2): 794–801. PMID 2829884. doi:10.1016/0006-291X(88)90461-5. 
  3. Peters CW, Kruse U, Pollwein R, Grzeschik KH, Sippel AE (July 1989). The human lysozyme gene. Sequence organization and chromosomal localization. Eur. J. Biochem. 182 (3): 507–16. PMID 2546758. doi:10.1111/j.1432-1033.1989.tb14857.x. 
  4. UniProt, P61626 (англ.). Архів оригіналу за 21 грудня 2018. Процитовано 30 листопада 2018. 
  5. Alexander Fleming (1881-1955): A noble life in science. The British Library Board. Архів оригіналу за 23 вересня 2014. Процитовано 2 лютого 2014. 

Див. також[ред. | ред. код]