Ацетилхолінестераза

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ацетилхолінестераза
PBB Protein ACHE image.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ACHE, AChE, acetylhydrolase, acetylcholinesterase (Yt blood group), ACEE, ARN-YT, acetylcholinesterase (Cartwright blood group), true cholinesterase (dated synonym)
Зовнішні ІД OMIM: 100740 MGI: 87876 HomoloGene: 543 GeneCards: ACHE
Пов'язані генетичні захворювання
Цукровий діабет 2-го типу[1]
Реагує на сполуку
донепезил, галантамін, неостигмін, physostigmine, Пралідоксим, піридостигмін, ривастигмін, такрин[2]
Шаблон експресії
PBB GE ACHE 205377 s at fs.png

PBB GE ACHE 205378 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001290010
NM_009599
RefSeq (білок)
NP_001276939
NP_033729
Локус (UCSC) Хр. 7: 100.89 – 100.9 Mb Хр. 5: 137.29 – 137.29 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Ацетилхолінестераза (англ. Acetylcholinesterase (Cartwright blood group)) — білок, який кодується геном ACHE, розташованим у людини на довгому плечі 7-ї хромосоми.[5][6][7]Довжина поліпептидного ланцюга білка становить 614 амінокислот, а молекулярна маса — 67 796[8].

Послідовність амінокислот
1020304050
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRG
IRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVC
YQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIY
GGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPG
NVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSR
GLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG
DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQ
VSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLA
AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEE
KIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLE
VRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL

Це фермент, що міститься в синапсах та каталізує гідроліз нейромедіатора ацетилхоліну до холіну і залишку оцтової кислоти. Реакція, що каталізується ацтилхолінестеразою, необхідна для дезактивації ацетилхоліну і переходу клітини-мішені в стан спокою (наприклад, для розслаблення м'язової клітини). Тому інгібітори ацетилхолінестерази (фосфорорганічні інсектициди, зарин, зоман і V-гази, фасцикулін і деякі інші пептиди зміїних отрут) — потужні токсини, дія яких на організм людини зазвичай призводить до смерті від судом дихальної мускулатури.

Локалізований також у клітинній мембрані, ядрі, клітинних контактах, може бути секретований назовні.

Тетрамер ацетилхолінестерази, Mus musculus.

Система груп крові Картрайта[ред. | ред. код]

Ацетилхолінестераза присутня на мембрані еритроцитів та може бути антигеном при переливанні крові. Існує кілька генетичних варіантів гену ацетилхолінестерази, які кодують різні варіанти поверхневого антигену еритроцитів. До 2010-х років окрім основного алеля Yt визначалося два мінорних алелі цієї системи групи крові: Yta та Ytb, залежно від нуклеотида в 1057-му положенні, що веде до заміни амінокислотного залишку в 353-му положенні — гістидини чи аспарагін. Генетичний аналіз із залученням секвенування наступного покоління виявив ще 3 поширені алелі: YTEG, YTLI і YTOT.[9]

Див. також[ред. | ред. код]

Примітки[ред. | ред. код]

  1. Захворювання, генетично пов'язані з ацетилхолінестераза переглянути/редагувати посилання на ВікіДаних. 
  2. Сполуки, які фізично взаємодіють з ацетилхолінестераза переглянути/редагувати посилання на ВікіДаних. 
  3. Human PubMed Reference:. 
  4. Mouse PubMed Reference:. 
  5. HUGO Gene Nomenclature Commitee, HGNC:108 (англ.). Архів оригіналу за 4 березня 2016. Процитовано 30 листопада 2018. 
  6. Ehrlich G, Viegas-Pequignot E, Ginzberg D, et al. (1992). Mapping the human acetylcholinesterase gene to chromosome 7q22 by fluorescent in situ hybridization coupled with selective PCR amplification from a somatic hybrid cell panel and chromosome-sorted DNA libraries.. Genomics 13 (4): 1192–7. PMID 1380483. doi:10.1016/0888-7543(92)90037-S. 
  7. Getman DK, Eubanks JH, Camp S, et al. (1992). The human gene encoding acetylcholinesterase is located on the long arm of chromosome 7.. Am. J. Hum. Genet. 51 (1): 170–7. PMID 1609795. 
  8. UniProt, P22303 (англ.). Архів оригіналу за 21 грудня 2018. Процитовано 30 листопада 2018. 
  9. George, M. R. (2019). An update on the Cartwright (Yt) blood group system [Архівовано 16 липня 2021 у Wayback Machine.]. Immunohematology, 35(4), 154—155(англ.)

Джерела[ред. | ред. код]

Література[ред. | ред. код]