BTK

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BTK
1bwn opm.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BTK, AGMX1, AT, ATK, BPK, IMD1, PSCTK1, XLA, Bruton tyrosine kinase, IGHD3
Зовнішні ІД OMIM: 300300 MGI: 88216 HomoloGene: 30953 GeneCards: BTK
Пов'язані генетичні захворювання
Bruton-type agammaglobulinemia[1]
Реагує на сполуку
ibrutinib[2]
Шаблон експресії
PBB GE BTK 205504 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001287345
NM_000061
NM_001287344
NM_013482
RefSeq (білок)
NP_000052
NP_001274273
NP_001274274
NP_038510
Локус (UCSC) Хр. X: 101.35 – 101.39 Mb Хр. X: 134.54 – 134.58 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BTK (англ. Bruton tyrosine kinase) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[5] Довжина поліпептидного ланцюга білка становить 659 амінокислот, а молекулярна маса — 76 281[6].

Послідовність амінокислот
1020304050
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRG
SKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPY
PFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDG
QYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKK
PLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLP
WWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKH
LFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPK
DLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMM
NLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLE
MCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDE
YTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSN
ILDVMDEES

Кодований геном білок за функціями належить до трансфераз, кіназ, тирозинових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, адаптивний імунітет, імунітет, вроджений імунітет, транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з АТФ, нуклеотидами, ліпідами, іонами металів, іоном цинку. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.

Література[ред. | ред. код]

  • Rohrer J., Parolini O., Belmont J.W., Conley M.E. (1994). The genomic structure of human BTK, the defective gene in X-linked agammaglobulinemia.. Immunogenetics 40: 319 — 324.  PubMed DOI:10.1007/BF01246672
  • Hagemann T.L., Chen Y., Rosen F.S., Kwan S.-P. (1994). Genomic organization of the Btk gene and exon scanning for mutations in patients with X-linked agammaglobulinemia.. Hum. Mol. Genet. 3: 1743 — 1749.  PubMed DOI:10.1093/hmg/3.10.1743
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Vihinen M., Nilsson L., Smith C.I. (1994). Tec homology (TH) adjacent to the PH domain.. FEBS Lett. 350: 263 — 265.  PubMed DOI:10.1016/0014-5793(94)00783-7
  • Yang W., Desiderio S. (1997). BAP-135, a target for Bruton's tyrosine kinase in response to B cell receptor engagement.. Proc. Natl. Acad. Sci. U.S.A. 94: 604 — 609.  PubMed DOI:10.1073/pnas.94.2.604
  • Varnai P., Rother K.I., Balla T. (1999). Phosphatidylinositol 3-kinase-dependent membrane association of the Bruton's tyrosine kinase pleckstrin homology domain visualized in single living cells.. J. Biol. Chem. 274: 10983 — 10989.  PubMed DOI:10.1074/jbc.274.16.10983

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]