NPY5R

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NPY5R
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NPY5R, NPY5-R, NPYR5, NPYY5-R, Neuropeptide Y receptor Y5
Зовнішні ІД OMIM: 602001 MGI: 108082 HomoloGene: 21241 GeneCards: NPY5R
Шаблон експресії
PBB GE NPY5R 207400 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006174
NM_001317091
NM_001317092
NM_016708
NM_001358957
NM_001358958
RefSeq (білок)
NP_001304020
NP_001304021
NP_006165
NP_057917
NP_001345886
NP_001345887
Локус (UCSC) Хр. 4: 163.34 – 163.35 Mb Хр. 8: 66.68 – 66.69 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NPY5R (англ. Neuropeptide Y receptor Y5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 445 амінокислот, а молекулярна маса — 50 727[4].

Послідовність амінокислот
1020304050
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTF
VSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLT
SVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNN
LTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVE
SWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLE
ENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHEL
RVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISN
RHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7958 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q15761 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]