SCTR

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SCTR
Ідентифікатори
Символи SCTR, SR, secretin receptor
Зовнішні ІД MGI: 2441720 HomoloGene: 68290 GeneCards: SCTR
Шаблон експресії
PBB GE SCTR 210382 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002980
NM_001012322
NM_001311077
RefSeq (білок)
NP_002971
NP_001012322
NP_001298006
Локус (UCSC) Хр. 2: 119.44 – 119.53 Mb Хр. 1: 120.01 – 120.06 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SCTR (англ. Secretin receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 440 амінокислот, а молекулярна маса — 50 207[4].

Послідовність амінокислот
1020304050
MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELS
REQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRN
GSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGY
SSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLF
SSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFS
ERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRG
PVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPL
FGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQ
KKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Jiang S., Ulrich C.D. (1995). Molecular cloning and functional expression of a human pancreatic secretin receptor.. Biochem. Biophys. Res. Commun. 207: 883 — 890.  PubMed DOI:10.1006/bbrc.1995.1268
  • Chow B.K.-C. (1995). Molecular cloning and functional characterization of a human secretin receptor.. Biochem. Biophys. Res. Commun. 212: 204 — 211.  PubMed DOI:10.1006/bbrc.1995.1957
  • Patel D.R., Kong Y., Sreedharan S.P. (1995). Molecular cloning and expression of a human secretin receptor.. Mol. Pharmacol. 47: 467 — 473.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:10608 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P47872 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]