P2RY6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
P2RY6
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи P2RY6, P2Y6, pyrimidinergic receptor P2Y6
Зовнішні ІД MGI: 2673874 HomoloGene: 14289 GeneCards: P2RY6
Реагує на сполуку
Аденозиндифосфат, 1-amino-4-((4-((4-chloro-6-((3-sulfophenyl)amino)-1,3,5-triazin-2-yl)amino)-3-sulfophenyl)amino)-9,10-dihydro-9,10-dioxo-2-anthracenesulfonic acid[1]
Шаблон експресії
PBB GE P2RY6 208373 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_183168
RefSeq (білок)
NP_898991
Локус (UCSC) Хр. 11: 73.26 – 73.3 Mb Хр. 7: 100.94 – 100.97 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

P2RY6 (англ. Pyrimidinergic receptor P2Y6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 328 амінокислот, а молекулярна маса — 36 429[5].

Послідовність амінокислот
1020304050
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQ
ICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACR
LVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVA
VWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIG
FLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAI
SFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Communi D., Parmentier M., Boeynaems J.-M. (1996). Cloning, functional expression and tissue distribution of the human P2Y6 receptor.. Biochem. Biophys. Res. Commun. 222: 303 — 308.  PubMed DOI:10.1006/bbrc.1996.0739
  • Maier R., Glatz A., Mosbacher J., Bilbe G. (1997). Cloning of P2Y6 cDNAs and identification of a pseudogene: comparison of P2Y receptor subtype expression in bone and brain tissues.. Biochem. Biophys. Res. Commun. 237: 297 — 302.  PubMed DOI:10.1006/bbrc.1997.7135
  • Maier R., Glatz A., Mosbacher J., Bilbe G. (1997). Biochem. Biophys. Res. Commun. 240: 298 — 302.  PubMed DOI:10.1006/bbrc.1997.7653
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]