TACR3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TACR3
Ідентифікатори
Символи TACR3, HH11, NK-3R, NK3R, NKR, TAC3RL, Tachykinin receptor 3, TAC3R, NK3
Зовнішні ІД OMIM: 162332 MGI: 892968 HomoloGene: 824 GeneCards: TACR3
Пов'язані генетичні захворювання
hypogonadotropic hypogonadism 11 with or without anosmia[1]
Реагує на сполуку
eledoisin, Kassinin, substance P, osanetant, saredutant[2]
Шаблон експресії
PBB GE TACR3 208183 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001059
NM_021382
RefSeq (білок)
NP_001050
NP_067357
Локус (UCSC) Хр. 4: 103.59 – 103.72 Mb Хр. 3: 134.83 – 134.93 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TACR3 (англ. Tachykinin receptor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 465 амінокислот, а молекулярна маса — 52 202[6].

Послідовність амінокислот
1020304050
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGN
LSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAV
LGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVNFIYALHSE
WYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATAT
KIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHII
VIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTM
YNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSM
YTVTRMESMTVVFDPNDADTTRSSRKKRATPRDPSFNGCSRRNSKSASAT
SSFISSPYTSVDEYS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Huang R.-R.C., Cheung A.H., Mazina K.E., Strader C.D., Fong T.M. (1992). cDNA sequence and heterologous expression of the human neurokinin-3 receptor.. Biochem. Biophys. Res. Commun. 184: 966 — 972.  PubMed DOI:10.1016/0006-291X(92)90685-E
  • Takahashi K., Tanaka A., Hara M., Nakanishi S. (1992). The primary structure and gene organization of human substance P and neuromedin K receptors.. Eur. J. Biochem. 204: 1025 — 1033.  PubMed DOI:10.1111/j.1432-1033.1992.tb16724.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]