LAMC3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
LAMC3
Ідентифікатори
Символи LAMC3, OCCM, laminin subunit gamma 3
Зовнішні ІД MGI: 1344394 HomoloGene: 21222 GeneCards: LAMC3
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006059
NM_011836
RefSeq (білок)
NP_006050
NP_035966
Локус (UCSC) Хр. 9: 131.01 – 131.09 Mb Хр. 2: 31.89 – 31.95 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

LAMC3 (англ. Laminin subunit gamma 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 575 амінокислот, а молекулярна маса — 171 227[4].

Послідовність амінокислот
1020304050
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQA
SHTCGSPPEDFCPHVGAAGAGAHCQRCDAADPQRHHNASYLTDFHSQDES
TWWQSPSMAFGVQYPTSVNITLRLGKAYEITYVRLKFHTSRPESFAIYKR
SRADGPWEPYQFYSASCQKTYGRPEGQYLRPGEDERVAFCTSEFSDISPL
SGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDRLNTFGDDIFK
DPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGG
RCHHCRDHTAGPHCERCQENFYHWDPRMPCQPCDCQSAGSLHLQCDDTGT
CACKPTVTGWKCDRCLPGFHSLSEGGCRPCTCNPAGSLDTCDPRSGRCPC
KENVEGNLCDRCRPGTFNLQPHNPAGCSSCFCYGHSKVCASTAQFQVHHI
LSDFHQGAEGWWARSVGGSEHPPQWSPNGVLLSPEDEEELTAPEKFLGDQ
RFSYGQPLILTFRVPPGDSPLPVQLRLEGTGLALSLRHSSLSGPQDAGHP
REVELRFHLQETSEDVAPPLPPFHFQRLLANLTSLRLRVSPGPSPAGPVF
LTEVRLTSARPGLSPPASWVEICSCPTGYTGQFCESCAPGYKREMPQGGP
YASCVPCTCNQHGTCDPNTGICVCSHHTEGPSCERCLPGFYGNPFAGQAD
DCQPCPCPGQSACTTIPESREVVCTHCPPGQRGRRCEVCDDGFFGDPLGL
FGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTTGDHCEHCQEGF
YGSALAPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTARDCSR
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRC
QLGFFGFSIKGCRACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDN
FFLTADGTHCQQCPSCYALVKEEAAKLKARLTLTEGWLQGSDCGSPWGPL
DILLGEAPRGDVYQGHHLLPGAREAFLEQMMSLEGAVKAAREQLQRLNKG
ARCAQAGSQKTCTQLADLEAVLESSEEEILHAAAILASLEIPQEGPSQPT
KWSHLATEARALARSHRDTATKIAATAWRALLASNTSYALLWNLLEGRVA
LETQRDLEDRYQEVQAAQKALRTAVAEVLPEAESVLATVQQVGADTAPYL
ALLASPGALPQKSRAEDLGLKAKALEKTVASWQHMATEAARTLQTAAQAT
LRQTEPLTKLHQEARAALTQASSSVQAATVTVMGARTLLADLEGMKLQFP
RPKDQAALQRKADSVSDRLLADTRKKTKQAERMLGNAAPLSSSAKKKGRE
AEVLAKDSAKLAKALLRERKQAHRRASRLTSQTQATLQQASQQVLASEAR
RQELEEAERVGAGLSEMEQQIRESRISLEKDIETLSELLARLGSLDTHQA
PAQALNETQWALERLRLQLGSPGSLQRKLSLLEQESQQQELQIQGFESDL
AEIRADKQNLEAILHSLPENCASWQ

Задіяний у такому біологічному процесі, як клітинна адгезія. Локалізований у позаклітинному матриксі, базальній мембрані. Також секретований назовні.

Література[ред. | ред. код]

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6494 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q9Y6N6 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]