COL1A1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
COL1A1
COL1A1 protein - PDB rendering based on 1y0f.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи COL1A1, EDSC, OI1, OI2, OI3, OI4, collagen type I alpha 1, collagen type I alpha 1 chain, EDSARTH1
Зовнішні ІД OMIM: 120150 MGI: 88467 HomoloGene: 73874 GeneCards: COL1A1
Пов'язані генетичні захворювання
рак молочної залози[1]
Шаблон експресії
PBB GE COL1A1 202310 s at fs.png

PBB GE COL1A1 202311 s at fs.png

PBB GE COL1A1 202312 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000088
NM_007742
RefSeq (білок)
NP_000079
NP_031768
Локус (UCSC) Хр. 17: 50.18 – 50.2 Mb Хр. 11: 94.94 – 94.95 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

COL1A1 (англ. Collagen type I alpha 1 chain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 1 464 амінокислот, а молекулярна маса — 138 941[5].

Послідовність амінокислот
1020304050
MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDR
DVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSE
SPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPP
GPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQG
FQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQ
GARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQ
MGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVG
AKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGAN
GAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGE
PGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGADG
VAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPD
GKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGV
PGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAG
PPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGAN
GAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGP
KGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPG
DRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPP
GPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGP
AGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPG
PQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPM
GPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGA
PGAPGPVGPAGKSGDRGETGPAGPTGPVGPVGARGPAGPQGPRGDKGETG
EQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAP
GKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF
LPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEG
SRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCV
YPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAI
QLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRA
EGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAP
DQEFGFDVGPVCFL

Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bornstein P., McKay J., Morishima J.K., Devarayalu S., Gelinas R.E. (1987). Regulatory elements in the first intron contribute to transcriptional control of the human alpha 1(I) collagen gene.. Proc. Natl. Acad. Sci. U.S.A. 84: 8869 — 8873.  PubMed DOI:10.1073/pnas.84.24.8869
  • Click E.M., Bornstein P. (1970). Isolation and characterization of the cyanogen bromide peptides from the alpha 1 and alpha 2 chains of human skin collagen.. Biochemistry 9: 4699 — 4706.  PubMed DOI:10.1021/bi00826a012
  • Chu M.-L., Myers J.C., Bernard M.P., Ding J.-F., Ramirez F. (1982). Cloning and characterization of five overlapping cDNAs specific for the human pro alpha 1(I) collagen chain.. Nucleic Acids Res. 10: 5925 — 5934.  PubMed DOI:10.1093/nar/10.19.5925
  • Barsh G.S., Roush C.L., Bonadio J., Byers P.H., Gelinas R.E. (1985). Intron-mediated recombination may cause a deletion in an alpha 1 type I collagen chain in a lethal form of osteogenesis imperfecta.. Proc. Natl. Acad. Sci. U.S.A. 82: 2870 — 2874.  PubMed DOI:10.1073/pnas.82.9.2870
  • Maekelae J.K., Raassina M., Virta A., Vuorio E. (1988). Human pro alpha 1(I) collagen: cDNA sequence for the C-propeptide domain.. Nucleic Acids Res. 16: 349 — 349.  PubMed DOI:10.1093/nar/16.1.349

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]