CACNA1G

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CACNA1G
Ідентифікатори
Символи CACNA1G, Ca(V)T.1, Cav3.1, NBR13, SCA42, calcium voltage-gated channel subunit alpha1 G, SCA42ND
Зовнішні ІД MGI: 1201678 HomoloGene: 22544 GeneCards: CACNA1G
Пов'язані генетичні захворювання
хвороба Альцгеймера[1]
Реагує на сполуку
Анандамід, mibefradil[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001112813
NM_001177888
NM_001177890
NM_009783
RefSeq (білок)
н/д
Локус (UCSC) Хр. 17: 50.56 – 50.63 Mb Хр. 11: 94.41 – 94.47 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CACNA1G (англ. Calcium voltage-gated channel subunit alpha1 G) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 2 377 амінокислот, а молекулярна маса — 262 472[6].

Послідовність амінокислот
1020304050
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEG
LPYPALAPVVFFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGM
FRPCEDIACDSQRCRILQAFDDFIFAFFAVEMVVKMVALGIFGKKCYLGD
TWNRLDFFIVIAGMLEYSLDLQNVSFSAVRTVRVLRPLRAINRVPSMRIL
VTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLPENFSLP
LSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQV
ITLEGWVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSE
TKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELLKYLVYILRKAARR
LAQVSRAAGVRVGLLSSPAPLGGQETQPSSSCSRSHRRLSVHHLVHHHHH
HHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGA
ESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
TLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKI
SSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDA
QHSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIM
IAILVNTLSMGIEYHEQPEELTNALEISNIVFTSLFALEMLLKLLVYGPF
GYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMRVLKLVRFLPA
LQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTF
GNYVLFNLLVAILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSE
SEPDFFSPSLDGDGDRKKCLALVSLGEHPELRKSLLPPLIIHTAATPMSL
PKSTSTGLGEALGPASRRTSSSGSAEPGAAHEMKSPPSARSSPHSPWSAA
SSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQDEEESSEEER
ASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCN
GKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLE
RDSWSAYIFPPQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKI
DPHSAERIFLTLSNYIFTAVFLAEMTVKVVALGWCFGEQAYLRSSWNVLD
GLLVLISVIDILVSMVSDSGTKILGMLRVLRLLRTLRPLRVISRAQGLKL
VVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNIT
NKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG
VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEE
EARRREEKRLRRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRF
RLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQILDEALKICNYIF
TVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLLSIMGITLEEIEVNAS
LPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLF
MLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVST
GDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVL
MKHLEESNKEAKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDS
PDSPKPGALHPAAHARSASHFSLEHPTDRQLFDTISLLIQGSLEWELKLM
DELAGPGGQPSAFPSAPSLGGSDPQIPLAEMEALSLTSEIVSEPSCSLAL
TDDSLPDDMHTLLLSALESNMQPHPTELPGPDLLTVRKSGVSRTHSLPND
SYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAP
HLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSRE
DLLAEVSGPSPPLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGP
EPNWGKGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVE
AQSCQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGS
RPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPD
SMAASPSPKKDVLSLSGLSSDPADLDP

Кодований геном білок за функціями належить до іонних каналів, потенціалзалежних каналів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, транспорт кальцію. Білок має сайт для зв'язування з іоном кальцію. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література[ред. | ред. код]

  • Mittman S., Guo J., Agnew W.S. (1999). Structure and alternative splicing of the gene encoding alpha1G, a human brain T calcium channel alpha1 subunit.. Neurosci. Lett. 274: 143 — 146.  PubMed DOI:10.1016/S0304-3940(99)00716-8
  • Cribbs L.L., Gomora J.C., Daud A.N., Lee J.-H., Perez-Reyes E. (2000). Molecular cloning and functional expression of ca(v)3.1c, a T-type calcium channel from human brain.. FEBS Lett. 466: 54 — 58.  PubMed DOI:10.1016/S0014-5793(99)01756-1
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Toyota M., Ho C., Ohe-Toyota M., Baylin S.B., Issa J.-P.J. (1999). Inactivation of CACNA1G, a T-type calcium channel gene, by aberrant methylation of its 5' CpG island in human tumors.. Cancer Res. 59: 4535 — 4541.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]