CD68

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CD68
Ідентифікатори
Символи CD68Gp110macrosialinCD68 antigenscavenger receptor class Dmember 1macrophage antigen CD68
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

CD68 (англ. CD68 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 354 амінокислот, а молекулярна маса — 37 408[2].

Послідовність амінокислот
1020304050
MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTS
HRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTAT
SQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPS
PTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK
TKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFP
HAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAA
QLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSA
YQAL

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, лізосомі, ендосомах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lewandrowski U., Moebius J., Walter U., Sickmann A. (2006). Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.. Mol. Cell. Proteomics 5: 226 — 233.  PubMed DOI:10.1074/mcp.M500324-MCP200
  • Holness C.L., Simmons D.L. (1993). Molecular cloning of CD68, a human macrophage marker related to lysosomal glycoproteins.. Blood 81: 1607 — 1613.  PubMed
  • Beranek J.T. (2005). CD68 is not a macrophage-specific antigen.. Ann. Rheum. Dis. 64: 342 — 343.  PubMed

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:1693 (англ.). Процитовано 21 вересня 2017. 
  2. UniProt, P34810 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]