SLC44A1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SLC44A1
Ідентифікатори
Символи CDw92CDW92 antigensolute carrier family 44 (choline transporter)member 1choline transporter-like protein 1SLC44A1
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

SLC44A1 (англ. Solute carrier family 44 member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 657 амінокислот, а молекулярна маса — 73 302[2].

Послідовність амінокислот
1020304050
MGCCSSASSAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSI
ATGAAARLVSGYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNL
DLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYT
TSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSV
LHRLISGVMTSKEIILGLCLLSLVLSMILMVIIRYISRVLVWILTILVIL
GSLGGTGVLWWLYAKQRRSPKETVTPEQLQIAEDNLRALLIYAISATVFT
VILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWV
YWIMTLLFLGTTGSPVQNEQGFVEFKISGPLQYMWWYHVVGLIWISEFIL
ACQQMTVAGAVVTYYFTRDKRNLPFTPILASVNRLIRYHLGTVAKGSFII
TLVKIPRMILMYIHSQLKGKENACARCVLKSCICCLWCLEKCLNYLNQNA
YTATAINSTNFCTSAKDAFVILVENALRVATINTVGDFMLFLGKVLIVCS
TGLAGIMLLNYQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLC
FAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPM
ASGASSA

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, мітохондрії, зовнішній мембрані мітохондрій.

Література[ред. | ред. код]

  • Traiffort E., Ruat M., O'Regan S., Meunier F.-M. (2005). Molecular characterization of the family of choline transporter-like proteins and their splice variants.. J. Neurochem. 92: 1116 — 1125.  PubMed DOI:10.1111/j.1471-4159.2004.02962.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Michel V., Bakovic M. (2009). The solute carrier 44A1 is a mitochondrial protein and mediates choline transport.. FASEB J. 23: 2749 — 2758.  PubMed DOI:10.1096/fj.08-121491

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:18798 (англ.). Процитовано 8 вересня 2017. 
  2. UniProt, Q8WWI5 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]