ABCB1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ABCB1
MDR3 3g5u.png
Ідентифікатори
Символи ABCB1, ABC20, CD243, CLCS, GP170, MDR1, P-GP, PGY1, ATP binding cassette subfamily B member 1, P-glycoprotein, P-gp, Pgp
Зовнішні ІД OMIM: 171050 MGI: 97570 HomoloGene: 55496 GeneCards: ABCB1
Пов'язані генетичні захворювання
inflammatory bowel disease 13[1]
Шаблон експресії
PBB GE ABCB1 209994 s at fs.png

PBB GE ABCB1 209993 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000927
NM_011076
RefSeq (білок)
NP_000918
NP_001335873
NP_001335874
NP_001335875
NP_035206
Локус (UCSC) н/д Хр. 5: 8.66 – 8.75 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ABCB1 (англ. ATP binding cassette subfamily B member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 280 амінокислот, а молекулярна маса — 141 479[5].

Послідовність амінокислот
1020304050
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLY
MVVGTLAAIIHGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDIND
TGFFMNLEEDMTRYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQ
FFHAIMRQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATF
FTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKA
GAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASP
SIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFS
YPSRKEVKILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGM
VSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRYGRENVTMDEI
EKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPK
ILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDA
LEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRI
MKLNLTEWPYFVVGVFCAIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQ
NSNLFSLLFLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQD
VSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNIANLGTGIIIS
FIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMY
FSYAGCFRFGAYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAK
AKISAAHIIMIIEKTPLIDSYSTEGLMPNTLEGNVTFGEVVFNYPTRPDI
PVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKE
IKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAK
EANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGR
VKEHGTHQQLLAQKGIYFSMVSVQAGTKRQ

Кодований геном білок за функціями належить до гідролаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Gekeler V., Weger S., Probst H. (1990). mdr1/P-glycoprotein gene segments analyzed from various human leukemic cell lines exhibiting different multidrug resistance profiles.. Biochem. Biophys. Res. Commun. 169: 796 — 802.  PubMed DOI:10.1016/0006-291X(90)90401-8
  • Kerb R., Hoffmeyer S., Brinkmann U. (2001). ABC drug transporters: hereditary polymorphisms and pharmacological impact in MDR1, MRP1 and MRP2.. Pharmacogenomics 2: 51 — 64.  PubMed DOI:10.1517/14622416.2.1.51
  • Begley G.S., Horvath A.R., Taylor J.C., Higgins C.F. (2005). Cytoplasmic domains of the transporter associated with antigen processing and P-glycoprotein interact with subunits of the proteasome.. Mol. Immunol. 42: 137 — 141.  PubMed DOI:10.1016/j.molimm.2004.07.005
  • Katayama K., Yamaguchi M., Noguchi K., Sugimoto Y. (2014). Protein phosphatase complex PP5/PPP2R3C dephosphorylates P-glycoprotein/ABCB1 and down-regulates the expression and function.. Cancer Lett. 345: 124 — 131.  PubMed DOI:10.1016/j.canlet.2013.12.007
  • Choi K.H., Chen C.-J., Kriegler M., Roninson I.B. (1988). An altered pattern of cross-resistance in multidrug-resistant human cells results from spontaneous mutations in the mdr1 (P-glycoprotein) gene.. Cell 53: 519 — 529.  PubMed DOI:10.1016/0092-8674(88)90568-5
  • Decleves X., Chevillard S., Charpentier C., Vielh P., Laplanche J.-L. (2000). A new polymorphism (N21D) in the exon 2 of the human MDR1 gene encoding the P-glycoprotein.. Hum. Mutat. 15: 486 — 486.  PubMed DOI:10.1002/(SICI)1098-1004(200005)15:5<486::AID-HUMU26>3.0.CO;2-P

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]