Пролактин

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Пролактин
PRL structure.png
Ідентифікатори
Символи growth hormone A1luteotropic hormoneprolactinPRLdecidual prolactinluteotropin
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

Пролактин (англ. Prolactin (PRL), від лат. pro — перед, раніше, на користь і лат. lac (lactis) — молоко), іноді лактогенний, або мамотропний, мамотрофний гормон — білок, який кодується геном PRL, розташованим у людини на короткому плечі 6-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 227 амінокислот, а молекулярна маса — 25 876[2]. Гормон тварин і людини, що синтезується лактогенними ацидофільними клітинами передньої частки гіпофіза, задньо-латеральна частка(у людини)[3][4]. У період вагітності клітини «біполяри гіпофізу» маммосоматотрофи також активно синтезують цей гормон. У людини його ще синтезують клітини мозку, що вказує на його додаткову функцію як нейропептиду[5]. Окрім того, гормон може синтезуватись тканинами організму поза межами мозку: слізна залоза (епітелій), лімфатичні вузли (епітелій), потова залоза (епітелій), молочна залоза (епітелій), шкіра (фібробласт), селезінка (лімфоцит), міометрій (міоцит), тимус (тимоцит), кістковий мозок («лімфоїдна клітина»).

Послідовність амінокислот
1020304050
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRA
VVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQA
QQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQ
TKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLL
HCLRRDSHKIDNYLKLLKCRIIHNNNC

Функція[ред. | ред. код]

Регулює лактацію у ссавців, диференціювання різних тканин, ростові та обмінні процеси, сприяє формуванню материнських інстинктів; у деяких тварин (щури, миші) пролактин контролює функцію жовтого тіла яєчників. У нижчих хребетних спричинює ряд ефектів, що сприяють процесам розмноження та виховування потомства.

На 1998 рік досліджено понад 390 функцій, які виконує пролактин в організмі людини[6]. Він також може відігравати роль у виживанні клітин шляхом придушення апоптозу[7].

Взаємодіє з пролактиновим рецептором на мембрані клітини.

Особливо посилено виробляється в організмі жінок під час вагітності та в період годування грудьми. Механізм дії пролактину полягає в активації біосинтезу різних типів рибонуклеїнових кислот в альвеолярній тканині молочної залози, що спричинює вироблення білків молока та їх секрецію.

Регуляція виділення[ред. | ред. код]

Найбільш впливовим, щодо синтезу та виділення пролактину вважають: дофамін, який є інгібітором, та нейромедіатори норадреналін та серотонін, які є стимуляторами. Проте, це лише "вершина айсберга" складних процесів регулювання.

Період напіввиведення з крові становить в середньому 30 хвилин.

Кількість пролактину різко зростає в людини через 60-90 хвилин від початку сну і зберігається такою аж до просинання. Причому, це не повязано з фазами сну, статтю, періодом доби коли триває сон. Після просинання концентрація гормону падає до нормальної[8]. Втім, амплітуда цих коливань значно вища в жінок[9].

Загальна кількість плазмового пролактину починає збільшуватись у вагітних жінок з 11 триместру і досягає максимума при пологах. Після пологів концентрація пролактину коливається, збільшується кожного разу після годування грудьми. До 6 місяців відновлюється нормальна секреція та кількість пролактину, причому у здорових жінок лактація зберігається.

Рівень пролактину зростає у чоловіків під час статевого акту, а піковий викид — є одним із факторів, що стимулює та забезпечує рухливість сперматозоїдів при еякуляції.

Структура[ред. | ред. код]

Пролактин — білок з молекулярною масою 22-25 кДа (кілька ізомерів), складається з одного поліпептидного ланцюга з трьома внутрішніми дисульфідними зв'язками.

У 2010 році виявлено існування великого пролактину (60 кДа) та макропролактину (150 кДа)[10]. Великий пролактин може «перетворюватись» у пролактин під дією певних факторів. Дослідження вторинної структури показали, що PRL є білком усе-α-спіраль і містить майже 50 % α-спіралей, тоді як залишок білка складається в неорганізовані петлеві структури.

Пролактин одержано в кристалічному вигляді.

Лабораторні дослідження[ред. | ред. код]

Середня нормальна кількість пролактину у крові людини:

  • США: менше 500 mIU/L (20 ng/mL чи µg/L) для жінок; менше 450 mI U/L для чоловіків
  • Україна: 6,6-23,3 нг/мл для жінок; 4,7-15,2 нг/мл для чоловіків [11]
  • Росія: до 20 нг/мл (до 400 мЕд/л) у чоловіків; до 27 нг/мл (до 550 мЕд/л ) у жінок
  • МЕТ(Міжнародне Ендокринологічне Товариство): до 25 мкг/л (1 мкг/л=21,2 мМО/л )для жінок[12]

Патологія[ред. | ред. код]

Підвищення концентрації пролактину в крові називають гіперпролактинемією, зниження — гіпопролактинемією.

Підвищення рівня пролактину спостерігається при пролактиномі — доброякісному новоутворенню (аденомі) гіпофіза.

Також при гіперсекреції можуть виникинути такі паталогічні стани як галакторея та аменорея.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Takahashi H., Nabeshima Y., Nabeshima Y., Ogata K., Takeuchi S. (1984). Molecular cloning and nucleotide sequence of DNA complementary to human decidual prolactin mRNA.. J. Biochem. 95: 1491 — 1499.  PubMed DOI:10.1093/oxfordjournals.jbchem.a134757
  • Shaw-Bruha C.M., Pirrucello S.J., Shull J.D. (1997). Expression of the prolactin gene in normal and neoplastic human breast tissues and human mammary cell lines: promoter usage and alternative mRNA splicing.. Breast Cancer Res. Treat. 44: 243 — 253.  PubMed DOI:10.1023/A:1005879103367
  • Shome B., Parlow A.F. (1977). Human pituitary prolactin (hPRL): the entire linear amino acid sequence.. J. Clin. Endocrinol. Metab. 45: 1112 — 1115.  PubMed DOI:10.1210/jcem-45-5-1112
  • Hattori N., Ikekubo K., Nakaya Y., Kitagawa K., Inagaki C. (2005). Immunoglobulin G subclasses and prolactin (PRL) isoforms in macroprolactinemia due to anti-PRL autoantibodies.. J. Clin. Endocrinol. Metab. 90: 3036 — 3044.  PubMed DOI:10.1210/jc.2004-1600
  • Keeler C., Dannies P.S., Hodsdon M.E. (2003). The tertiary structure and backbone dynamics of human prolactin.. J. Mol. Biol. 328: 1105 — 1121.  PubMed DOI:10.1016/S0022-2836(03)00367-X

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:9445 (англ.). Процитовано 26 квітня 2018. 
  2. UniProt, P01236 (англ.). Процитовано 26 квітня 2018. 
  3. Melmed, S; Polonsky, KS; Larsen, PR; Kronenberg, HM (2011). Williams Textbook of Endocrinology (вид. 11th). Saunders. с. 478–479. ISBN 978-1416029113. 
  4. Шевчук, В. Г., В. М. Мороз, С. М. Бєлан, М. Р. Гжегоцький, М. В. Йолтухівський (2015). Фізіологія. (вид. 2, Підручник для ВМНЗ IV р.). Вінниця: Нова Книга. ISBN 9789663825328. 
  5. Grattan D.R. and Kokay I.C. Prolactin: A Pleiotropic Neuroendocrine Hormone Journal of Neuroendocrinology. 2008, 20, 752—763.doi: 10.1111/j.1365-2826.2008.01736.x
  6. Bole‐Feysot C, Goffin V, Edery M, Binart N, Kelly PA. Prolactin (PRL) and its receptor: actions, signal transduction pathways and phenotypes observed in PRL receptor knockout mice. Endocr Rev 1998; 19: 225—268. PMID: 9626554 doi 10.1210/edrv.19.3.0334
  7. PRL prolactin Homo sapiens (human), 2019
  8. Синдром гіперпролактинемії без пухлини гіпофіза: сучасна діагностика і лікування. В. М. Конах, 2018
  9. Waldstreicher, J; Duffy, J F; Brown, E N; Rogacz, S; Allan, J S; Czeisler, C A (1996). Gender differences in the temporal organization of proclactin (PRL) secretion: evidence for a sleep-independent circadian rhythm of circulating PRL levels- a clinical research center study.. The Journal of Clinical Endocrinology & Metabolism 81 (4): 1483–1487. ISSN 0021-972X. doi:10.1210/jcem.81.4.8636355. (англ.)
  10. Thomas P. Smith, Michael N. Fahie-Wilson. Reporting of Post–PEG Prolactin Concentrations: Time to Change. doi 10.1373/clinchem.2009.135210
  11. (рос.)ВIКОВI НОРМИ ВМIСТУ ПРОЛАКТИНУ В СИРОВАТЦI КРОВI ЗДОРОВИХ ДОБРОВОЛЬЦIВ, 2015
  12. (рос.)Диагностика и лечение гиперпролактинемии: Клинические рекомендации Международного. Эндокринологического общества, 2011

Див. також[ред. | ред. код]