Альфа-актин 2

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з ACTA2)
Перейти до навігації Перейти до пошуку
Альфа-актин 2
Protein ACTA2 PDB 1atn.png
Ідентифікатори
Символи ACTA2, AAT6, ACTSA, MYMY5, actin, alpha 2, smooth muscle, aorta, actin alpha 2, smooth muscle
Зовнішні ІД OMIM: 102620 MGI: 87909 HomoloGene: 133938 GeneCards: ACTA2
Шаблон експресії
PBB GE ACTA2 200974 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001141945
NM_001613
NM_001320855
NM_007392
RefSeq (білок)
NP_001135417
NP_001307784
NP_001604
NP_031418
Локус (UCSC) Хр. 10: 88.94 – 88.99 Mb Хр. 19: 34.24 – 34.26 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Альфа-актин 2 (англ. Actin, alpha 2, smooth muscle, aorta) – білок, який кодується геном ACTA2, розташованим у людей на короткому плечі 10-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 377 амінокислот, а молекулярна маса — 42 009[4].

Послідовність амінокислот
1020304050
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG
QKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAP
EEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRT
TGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGY
SFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVI
TIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS
LSTFQQMWISKQEYDEAGPSIVHRKCF

Цей білок за функцією належить до м'язових білків. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Kamada S., Kakunaga T. (1989). The nucleotide sequence of a human smooth muscle alpha-actin (aortic type) cDNA.. Nucleic Acids Res. 17: 1767 — 1767.  PubMed DOI:10.1093/nar/17.4.1767
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ueyama H., Hamada H., Battula N., Kakunaga T. (1984). Structure of a human smooth muscle actin gene (aortic type) with a unique intron site.. Mol. Cell. Biol. 4: 1073 — 1078.  PubMed DOI:10.1128/MCB.4.6.1073
  • Kamada S., Nakano Y., Kakunaga T. (1989). Structure of 3'-downstream segment of the human smooth muscle (aortic-type) alpha-actin-encoding gene and isolation of the specific DNA probe.. Gene 84: 455 — 462.  PubMed DOI:10.1016/0378-1119(89)90520-9
  • Leong W.F., Chow V.T. (2006). Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.. Cell. Microbiol. 8: 565 — 580.  PubMed DOI:10.1111/j.1462-5822.2005.00644.x

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:130 (англ.). Процитовано 6 лютого 2017. 
  4. UniProt, P62736 (англ.). Процитовано 6 лютого 2017. 

Див. також[ред. | ред. код]