MYO18A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYO18A
Ідентифікатори
Символи MYO18A, MYSPDZ, SPR210, myosin XVIIIA, MAJN, SP-R210
Зовнішні ІД OMIM: 610067 MGI: 2667185 HomoloGene: 7977 GeneCards: MYO18A
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001291212
NM_001291213
NM_001291214
NM_001291215
NM_011586
RefSeq (білок)
NP_001278141
NP_001278142
NP_001278143
NP_001278144
NP_035716
Локус (UCSC) Хр. 17: 29.07 – 29.18 Mb Хр. 11: 77.76 – 77.87 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYO18A (англ. Myosin XVIIIA) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 2 054 амінокислот, а молекулярна маса — 233 115[4].

Послідовність амінокислот
1020304050
MFNLMKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNR
SSKRESKTRLEISNPIPIKVASGSDLHLTDIDSDSNRGSVILDSGHLSTA
SSSDDLKGEEGSFRGSVLQRAAKFGSLAKQNSQMIVKRFSFSQRSRDESA
SETSTPSEHSAAPSPQVEVRTLEGQLVQHPGPGIPRPGHRSRAPELVTKK
FPVDLRLPPVVPLPPPTLRELELQRRPTGDFGFSLRRTTMLDRGPEGQAC
RRVVHFAEPGAGTKDLALGLVPGDRLVEINGHNVESKSRDEIVEMIRQSG
DSVRLKVQPIPELSELSRSWLRSGEGPRREPSDAKTEEQIAAEEAWNETE
KVWLVHRDGFSLASQLKSEELNLPEGKVRVKLDHDGAILDVDEDDVEKAN
APSCDRLEDLASLVYLNESSVLHTLRQRYGASLLHTYAGPSLLVLGPRGA
PAVYSEKVMHMFKGCRREDMAPHIYAVAQTAYRAMLMSRQDQSIILLGSS
GSGKTTSCQHLVQYLATIAGISGNKVFSVEKWQALYTLLEAFGNSPTIIN
GNATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNVFYY
LLACGDGTLRTELHLNHLAENNVFGIVPLAKPEEKQKAAQQFSKLQAAMK
VLGISPDEQKACWFILAAIYHLGAAGATKEAAEAGRKQFARHEWAQKAAY
LLGCSLEELSSAIFKHQHKGGTLQRSTSFRQGPEESGLGDGTGPKLSALE
CLEGMAAGLYSELFTLLVSLVNRALKSSQHSLCSMMIVDTPGFQNPEQGG
SARGASFEELCHNYTQDRLQRLFHERTFVQELERYKEENIELAFDDLEPP
TDDSVAAVDQASHQSLVRSLARTDEARGLLWLLEEEALVPGASEDTLLER
LFSYYGPQEGDKKGQSPLLHSSKPHHFLLGHSHGTNWVEYNVTGWLNYTK
QNPATQNAPRLLQDSQKKIISNLFLGRAGSATVLSGSIAGLEGGSQLALR
RATSMRKTFTTGMAAVKKKSLCIQMKLQVDALIDTIKKSKLHFVHCFLPV
AEGWAGEPRSASSRRVSSSSELDLPSGDHCEAGLLQLDVPLLRTQLRGSR
LLDAMRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHGRNYIVVDERRAVE
ELLECLDLEKSSCCMGLSRVFFRAGTLARLEEQRDEQTSRNLTLFQAACR
GYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKLFTTVRPLIEVQ
LSEEQIRNKDEEIQQLRSKLEKAEKERNELRLNSDRLESRISELTSELTD
ERNTGESASQLLDAETAERLRAEKEMKELQTQYDALKKQMEVMEMEVMEA
RLIRAAEINGEVDDDDAGGEWRLKYERAVREVDFTKKRLQQEFEDKLEVE
QQNKRQLERRLGDLQADSEESQRALQQLKKKCQRLTAELQDTKLHLEGQQ
VRNHELEKKQRRFDSELSQAHEEAQREKLQREKLQREKDMLLAEAFSLKQ
QLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAK
VKDQEEELDEQAGTIQMLEQAKLRLEMEMERMRQTHSKEMESRDEEVEEA
RQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEGKLATLSDQVNRRDFES
EKRLRKDLKRTKALLADAQLMLDHLKNSAPSKREIAQLKNQLEESEFTCA
AAVKARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEE
DQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEANKEKQELQEKLQAL
QSQVEFLEQSMVDKSLVSRQEAKIRELETRLEFERTQVKRLESLASRLKE
NMEKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGELARKEAEASRK
KHELEMDLESLEAANQSLQADLKLAFKRIGDLQAAIEDEMESDENEDLIN
SLQDMVTKYQKRKNKLEGDSDVDSELEDRVDGVKSWLSKNKGPSKAASDD
GSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLT
ETNA

Кодований геном білок за функціями належить до білкових моторів, міозинів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, апараті гольджі.

Література[ред. | ред. код]

  • Homma K., Kikuno R.F., Nagase T., Ohara O., Nishikawa K. (2004). Alternative splice variants encoding unstable protein domains exist in the human brain.. J. Mol. Biol. 343: 1207 — 1220.  PubMed DOI:10.1016/j.jmb.2004.09.028
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tan I., Yong J., Dong J.M., Lim L., Leung T. (2008). A tripartite complex containing MRCK modulates lamellar actomyosin retrograde flow.. Cell 135: 123 — 136.  PubMed DOI:10.1016/j.cell.2008.09.018
  • Ng M.M., Dippold H.C., Buschman M.D., Noakes C.J., Field S.J. (2013). GOLPH3L antagonizes GOLPH3 to determine Golgi morphology.. Mol. Biol. Cell 24: 796 — 808.  PubMed DOI:10.1091/mbc.E12-07-0525

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:31104 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q92614 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]