KRT27

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT27
Ідентифікатори
Символи KRT27, KRT25C, K25IRS3, keratin 27
Зовнішні ІД OMIM: 616676 MGI: 1339999 HomoloGene: 7805 GeneCards: KRT27
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_181537
NM_010666
RefSeq (білок)
NP_853515
NP_034796
Локус (UCSC) Хр. 17: 40.78 – 40.78 Mb Хр. 11: 99.35 – 99.35 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT27 (англ. Keratin 27) – білок, який кодується однойменним геном, розташованим у людей на 17-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 459 амінокислот, а молекулярна маса — 49 822[4].

Послідовність амінокислот
1020304050
MSVRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCGVPGIGSGFSCAFG
GSSSAGGYGGGLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLE
NVRALEEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDELKNQII
SATTSNAHVVLQNDNARLTADDFRLKFENELALHQSVEADINGLRRVLDE
LTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGNVNVEMNAAPG
VDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSA
RNELIEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQI
GALEEQLHQVRTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCS
KSKGYGGPGNQTKDSSKTTIVKTVVEEIDPRGKVLSSRVHTVEEKSTKVN
NKNEQRVSS

Локалізований у цитоплазмі, проміжних філаментах.

Література[ред. | ред. код]

  • Rogers M.A., Winter H., Langbein L., Bleiler R., Schweizer J. (2004). The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.. Differentiation 72: 527 — 540.  PubMed DOI:10.1111/j.1432-0436.2004.07209006.x

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:30841 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, Q7Z3Y8 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]