Тропоміозин 3

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з TPM3)
Перейти до навігації Перейти до пошуку
Тропоміозин 3
Protein TPM3 PDB 1mv4.png
Ідентифікатори
Символи TPM3, CAPM1, CFTD, HEL-189, HEL-S-82p, NEM1, OK/SW-cl.5, TM-5, TM3, TM30, TM30nm, TM5, TPMsk3, TRK, hscp30, Tropomyosin 3, TPM3nu
Зовнішні ІД OMIM: 191030 MGI: 1890149 HomoloGene: 81889 GeneCards: TPM3
Пов'язані генетичні захворювання
nemaline myopathy 1[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 1: 154.16 – 154.19 Mb Хр. 3: 90.07 – 90.1 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Тропоміозин 3 (англ. Tropomyosin 3) – білок, який кодується геном TPM3, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 285 амінокислот, а молекулярна маса — 32 950[5].

Послідовність амінокислот
1020304050
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKK
LKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEEL
DRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLK
EAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKN
VTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKL
EKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI

Цей білок за функцією належить до м'язових білків. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Reinach F.C., McLeod A.R. (1986). Tissue-specific expression of the human tropomyosin gene involved in the generation of the trk oncogene.. Nature 322: 648 — 650.  PubMed DOI:10.1038/322648a0
  • McLeod A.R., Houlker C., Talbot K. (1986). The mRNA and RNA-copy pseudogenes encoding TM30nm, a human cytoskeletal tropomyosin.. Nucleic Acids Res. 14: 8413 — 8426.  PubMed DOI:10.1093/nar/14.21.8413
  • Clayton L., Reinach F.C., Chumbley G.M., MacLeod A.R. (1988). Organization of the hTMnm gene. Implications for the evolution of muscle and non-muscle tropomyosins.. J. Mol. Biol. 201: 507 — 515.  PubMed DOI:10.1016/0022-2836(88)90633-X
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Marques A.C., Dupanloup I., Vinckenbosch N., Reymond A., Kaessmann H. (2005). Emergence of young human genes after a burst of retroposition in primates.. PLoS Biol. 3: E357 — E357.  PubMed DOI:10.1371/journal.pbio.0030357
  • Martin-Zanca D., Hughes S.H., Barbacid M. (1986). A human oncogene formed by the fusion of truncated tropomyosin and protein tyrosine kinase sequences.. Nature 319: 743 — 748.  PubMed DOI:10.1038/319743a0

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]