DST

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DST
Protein DST PDB 2iak.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи DST, BP240, BPA, BPAG1, CATX-15, CATX15, D6S1101, DMH, DT, EBSB2, HSAN6, MACF2, dystonin
Зовнішні ІД OMIM: 113810 HomoloGene: 134369 GeneCards: DST
Шаблон експресії
PBB GE DST 212253 x at fs.png

PBB GE DST 212254 s at fs.png

PBB GE DST 215016 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
н/д
Локус (UCSC) Хр. 6: 56.46 – 56.95 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DST (англ. Dystonin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 7 570 амінокислот, а молекулярна маса — 860 662[4].

Послідовність амінокислот
1020304050
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLM
KVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIAL
DYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESED
MSAKERLLLWTQQATEGYAGIRCENFTTCWRDGKLFNAIIHKYRPDLIDM
NTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSL
YDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLL
QGYHPNDIEKEWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVIC
EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI
LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
GITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPS
VTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEE
FESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDT
LHNFVSRATNELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMRELDQ
KEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQH
IKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQES
MEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVD
LANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTM
LPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQE
LLKSAEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLH
ESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSEL
NVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEA
VIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTY
KERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYH
PLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDE
CQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEF
MDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEHVEKAKELQ
KWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLA
KHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEK
LDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPE
LRKCFDLKDAKSHGLIDEQILCQLKELSKAKEIISAASPTTIPVLDALAQ
SMITESMAIKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVL
ERQNMCKDLIDPCTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITL
KCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAV
REGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALL
VLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNGRQKIAALY
IPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACKNARR
WLSFCKFQPSTVHDYRQEEDVFDGEEPVTTQTSEETKKLFLSYLMINSYM
DANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLDVLSSSGVFL
NNASGREKDECTATPSSFNKCHCGEPEHEETPENRKCAIDEEFNEMRNTV
INSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSD
SENILTNYENQSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFC
GVNETENEDNTNRDSPIFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNG
NKCEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLN
MISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDESEIEEYSCAV
TPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDD
FYDTPLFEDDDHDSLLLDGDDRDCLHPEDYDTLQEENDETASPADVFYDV
SKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPV
GSDKVNGQSLETGSERECTNILEGDESDSLTDYDIVGGKESFTASLKFDD
SGSWRGRKEEYVTGQEFHSDTDHLDSMQSEESYGDYIYDSNDQDDDDDDG
IDEEGGGIRDENGKPRCQNVAEDMDIQLCASILNENSDENENINTMILLD
KMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLL
NHEMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKV
KLIQGSELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTEPDLIGKPAEE
SHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGEGEVL
VEGLVEEENRHLKLLPGKNTRDSFKLINSQFPFPQITNNEELNQKGSLKK
ATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDDITSDITSWE
GNTHFEESFTDGPEKELDLFTYLKHCAKNIKAKDVAKPNEDVPSHVLITA
PPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEIS
QFTPESIEATLSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDY
SFLEINNKKERIEQQLPKEQALSPRSQEKEVQIPELSQVFVEDVKDILKS
RLKEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQM
SDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQDQHSQKITGV
FELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDF
NQKACSTSEMMEEKPHILGDIKSKEGNYYSPNLETVKEIGLESSTVWAST
LPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEK
MHEYLTLLQDMKPPLDNQESLDNNLEALKNQLRQLETFELGLAPIAVILR
KDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSLSNVSSERTKQI
MLAIDSEMSKLAVSHEEFLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEYV
KKRLEFLKNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRL
LNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQ
GICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQAL
AEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKE
LDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKDSERAGTKH
KQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQY
QKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKEL
KVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLE
AGADDINGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKR
DGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYE
DASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQ
VAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERNE
KLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKN
IMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEA
SHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVT
ELSQYMQESTSEFLEHKKHLEVLHSLLKEISSHGLPSDKALVLEKTNNLS
KKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQP
SFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAK
AIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLL
LKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEA
VKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLT
EIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSV
LGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGILSRPGEDP
SLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSD
KLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALC
EDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQ
FQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQS
HMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKL
KESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSL
QKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQL
HSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKY
LTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQ
EHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPV
GRDAETLQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVG
IKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKA
EEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLI
QSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDA
LESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVE
VIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGIS
VVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDD
IINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHS
RSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQ
SELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARY
KDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVL
KGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEK
MVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKK
LMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACS
EEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELW
PWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKT
GPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQF
HDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQP
LYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEERE
AKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEA
AETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDS
LNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDL
ETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDP
LMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLL
SEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAG
EEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQ
WLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQKG
QQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEF
HNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHRE
QIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLD
DARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEF
QKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDMLSELRDKWDTICG
KSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLV
MNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELS
TRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGV
LPDDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITT
IKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWA
ETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRR
AADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNLLVS
KWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKS
RVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGD
GYIDYYEFVAALHPNKDAYKPITDADKIEDEVTRQVAKCKCAKRFQVEQI
GDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPC
RVHHHGSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADGASQGMAA
FRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKGTPIQGSK
LRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKA
GSRASSRRGSDASDFDISEIQSVCSDVETVPQTHRPTPRAGSRPSTAKPS
KIPTPQRKSPASKLDKSSKR

Кодований геном білок за функціями належить до м'язових білків, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинна адгезія, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном кальцію. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані, клітинних контактах, ендоплазматичному ретикулумі, клітинних відростках.

Література[ред. | ред. код]

  • Elgart G.W., Stanley J.R. (1993). Cloning of the 5' mRNA for the 230-kD bullous pemphigoid antigen by rapid amplification of cDNA ends.. J. Invest. Dermatol. 101: 244 — 246.  PubMed DOI:10.1111/1523-1747.ep12365083
  • Okumura M., Yamakawa H., Ohara O., Owaribe K. (2002). Novel alternative splicings of BPAG1 (bullous pemphigoid antigen 1) including the domain structure closely related to MACF (microtubule actin cross-linking factor).. J. Biol. Chem. 277: 6682 — 6687.  PubMed DOI:10.1074/jbc.M109209200
  • Brown A., Dalpe G., Mathieu M., Kothary R. (1995). Cloning and characterization of the neural isoforms of human dystonin.. Genomics 29: 777 — 780.  PubMed DOI:10.1006/geno.1995.9936
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Stanley J.R., Tanaka T., Mueller S., Klaus-Kovtun V., Roop D. (1988). Isolation of complementary DNA for bullous pemphigoid antigen by use of patients' autoantibodies.. J. Clin. Invest. 82: 1864 — 1870.  PubMed DOI:10.1172/JCI113803
  • Hopkinson S.B., Jones J.C. (1994). Identification of a second protein product of the gene encoding a human epidermal autoantigen.. Biochem. J. 300: 851 — 857.  PubMed DOI:10.1042/bj3000851

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1090 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q03001 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]