MYH4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYH4
PDB 1o1g EBI.jpg
Ідентифікатори
Символи MYH4, MYH2B, MyHC-2B, MyHC-IIb, myosin, heavy chain 4, skeletal muscle, myosin heavy chain 4
Зовнішні ІД OMIM: 160742 MGI: 1339713 HomoloGene: 123880 GeneCards: MYH4
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_017533
NM_010855
RefSeq (білок)
NP_060003
NP_034985
Локус (UCSC) Хр. 17: 10.44 – 10.47 Mb Хр. 11: 67.24 – 67.26 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYH4 (англ. Myosin heavy chain 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 939 амінокислот, а молекулярна маса — 223 071[4].

Послідовність амінокислот
1020304050
MSSDSEMAIFGEAAPFLRKSEKERIEAQNKPFDAKTSVFVVDPKESYVKA
IVQSREGGKVTAKTEAGATVTVKEDQVFSMNPPKYDKIEDMAMMTHLHEP
AVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVTAYRGKKRQE
APPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIA
VTGEKKKEEPASGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKF
IRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPEL
IEMLLITTNPYDFAFVSQGEITVPSIDDQEELMATDSAVDILGFTADEKV
AIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLK
SLCYPRVKVGNEFVTKGQTVQQVYNAVGALAKAIYEKMFLWMVTRINQQL
DTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLE
QEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTS
FKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLVHYAGTVDYNIAGWLDKN
KDPLNETVVGLYQKSAMKTLAFLFSGAQTAEAEGGGGKKGGKKKGSSFQT
VSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCN
GVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLL
GSIEIDHTQYKFGHTKVFFKAGLLGTLEEMRDEKLAQLITRTQAICRGFL
MRVEFRKMMERRESIFCIQYNIRAFMNVKHWPWMKLYFKIKPLLKSAETE
KEMANMKEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEAD
ALADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDE
CSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEK
KALQEAHQQTLDDLQMEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLCM
DLERAKRKLEGDLKLAQESTMDTENDKQQLNEKLKKKEFEMSNLQGKIED
EQALAIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEI
SERLEEAGGATSAQIEMNKKREAEFQKMRRDLEESTLQHEATAAALRKKH
ADSVAELGEQIDSLQRVKQKLEKEKSELKMEINDLASNMETVSKAKANFE
KMCRTLEDQLSEIKTKEEEQQRLINELSAQKARLHTESGEFSRQLDEKDA
MVSQLSRGKQAFTQQIEELKRQLEEETKAKSTLAHALQSARHDCDLLREQ
YEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQR
LQDAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERSNAACIALDKKQ
RNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDHLE
TLKRENKNLQQEISDLTEQIAEGGKHIHELEKVKKQLDHEKSELQTSLEE
AEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEELDQLKRNHLRVVES
MQSTLDAEIRSRNDALRIKKKMEGDLNEMEIQLNHANRQAAEALRNLRNT
QGILKDTQLHLDDAIRGQDDLKEQLAMVERRANLMQAEVEELRASLERTE
RGRKMAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIVQ
EARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLR
LDEAEQLALKGGKKQIQKLEARVRELESEVESEQKHNVEAVKGLRKHERR
VKELTYQTEEDRKNILRLQDLVDKLQTKVKAYKRQAEEAEEQSNVNLAKF
RKLQHELEEAKERADIAESQVNKLRVKSREVHTKVISEE

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків, фосфопротеїнів. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • Weiss A., Schiaffino S., Leinwand L.A. (1999). Comparative sequence analysis of the complete human sarcomeric myosin heavy chain family: implications for functional diversity.. J. Mol. Biol. 290: 61 — 75.  PubMed DOI:10.1006/jmbi.1999.2865

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7574 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9Y623 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]