TUBA3E

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TUBA3E
Ідентифікатори
Символи TUBA3E, tubulin alpha 3e
Зовнішні ІД MGI: 1095408 HomoloGene: 128229 GeneCards: TUBA3E
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_207312
NM_009449
RefSeq (білок)
NP_997195
NP_033472
Локус (UCSC) Хр. 2: 130.19 – 130.2 Mb Хр. 6: 145.62 – 145.62 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TUBA3E (англ. Tubulin alpha 3e) – білок, який кодується однойменним геном, розташованим у людей на 2-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 450 амінокислот, а молекулярна маса — 49 859[4].

Послідовність амінокислот
1020304050
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN
TFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAA
SNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFA
SLLMERLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDC
AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV
DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLVHKFDLMYA
KWAFVHWYVGEGMEEGEFSEAREDLAALEKDCEEVGVDSVEAEAEEGEAY

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Valenstein M.L., Roll-Mecak A. (2016). Graded control of microtubule severing by tubulin glutamylation.. Cell 164: 911 — 921.  PubMed DOI:10.1016/j.cell.2016.01.019
  • Nirschl J.J., Magiera M.M., Lazarus J.E., Janke C., Holzbaur E.L. (2016). Alpha-tubulin tyrosination and CLIP-170 phosphorylation regulate the initiation of dynein-driven transport in neurons.. Cell Rep. 14: 2637 — 2652.  PubMed DOI:10.1016/j.celrep.2016.02.046

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:20765 (англ.). Процитовано 18 вересня 2017. 
  4. UniProt, Q6PEY2 (англ.). Процитовано 18 вересня 2017. 

Див. також[ред. | ред. код]