Гамма-актин-1

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з ACTG1)
Перейти до навігації Перейти до пошуку
Гамма-актин-1
Protein ACTG1 PDB 1atn.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ACTG1, ACT, ACTG, BRWS2, DFNA20, DFNA26, HEL-176, actin gamma 1
Зовнішні ІД OMIM: 102560 MGI: 87906 HomoloGene: 74402 GeneCards: ACTG1
Пов'язані генетичні захворювання
autosomal dominant nonsyndromic deafness 20, nonsyndromic deafness[1]
Шаблон експресії
PBB GE ACTG1 201550 x at fs.png

PBB GE ACTG1 211983 x at fs.png

PBB GE ACTG1 211970 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001199954
NM_001614
NM_009609
NM_001313923
RefSeq (білок)
NP_001186883
NP_001605
NP_001300852
NP_033739
Локус (UCSC) Хр. 17: 81.51 – 81.52 Mb Хр. 11: 120.35 – 120.35 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Гамма-актин-1 (англ. Actin gamma 1) – білок, який кодується геном ACTG1, розташованим у людей на короткому плечі 17-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 375 амінокислот, а молекулярна маса — 41 793[5].

Послідовність амінокислот
1020304050
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK
DSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE
HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG
IVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSF
TTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITI
GNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS
TFQQMWISKQEYDESGPSIVHRKCF

Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Erba H.P., Gunning P., Kedes L. (1986). Nucleotide sequence of the human gamma cytoskeletal actin mRNA: anomalous evolution of vertebrate non-muscle actin genes.. Nucleic Acids Res. 14: 5275 — 5294.  PubMed DOI:10.1093/nar/14.13.5275
  • Erba H.P., Eddy R., Shows T., Kedes L., Gunning P. (1988). Structure, chromosome location, and expression of the human gamma-actin gene: differential evolution, location, and expression of the cytoskeletal beta- and gamma-actin genes.. Mol. Cell. Biol. 8: 1775 — 1789.  PubMed DOI:10.1128/MCB.8.4.1775
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]