PPL

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PPL
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PPL, periplakin
Зовнішні ІД OMIM: 602871 MGI: 1194898 HomoloGene: 2026 GeneCards: PPL
Шаблон експресії
PBB GE PPL 203407 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002705
NM_008909
RefSeq (білок)
NP_002696
NP_032935
Локус (UCSC) Хр. 16: 4.88 – 4.96 Mb Хр. 16: 5.09 – 5.13 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PPL (англ. Periplakin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 756 амінокислот, а молекулярна маса — 204 747[4].

Послідовність амінокислот
1020304050
MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEA
KMQSDLARLQEGRQPEHRDVTLQKVLDSEKLLYVLEADAAIAKHMKHPQG
DMIAEDIRQLKERVTNLRGKHKQIYRLAVKEVDPQVNWAALVEEKLDKLN
NQSFGTDLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSELRAKYQK
LLAASQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPS
RRRQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHA
DWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPD
FKDRYQIELLLRELDDQEKVLDKYEDVVQGLQKRGQQVVPLKYRRETPLK
PIPVEALCDFEGEQGLISRGYSYTLQKNNGESWELMDSAGNKLIAPAVCF
VIPPTDPEALALADSLGSQYRSVRQKAAGSKRTLQQRYEVLKTENPGDAS
DLQGRQLLAGLDKVASDLDRQEKAITGILRPPLEQGRAVQDSAERAKDLK
NITNELLRIEPEKTRSTAEGEAFIQALPGSGTTPLLRTRVEDTNRKYEHL
LQLLDLAQEKVDVANRLEKSLQQSWELLATHENHLNQDDTVPESSRVLDS
KGQELAAMACELQAQKSLLGEVEQNLQAAKQCSSTLASRFQEHCPDLERQ
EAEVHKLGQRFNNLRQQVERRAQSLQSAKAAYEHFHRGHDHVLQFLVSIP
SYEPQETDSLSQMETKLKNQKNLLDEIASREQEVQKICANSQQYQQAVKD
YELEAEKLRSLLDLENGRRSHVSKRARLQSPATKVKEEEAALAAKFTEVY
AINRQRLQNLEFALNLLRQQPEVEVTHETLQRNRPDSGVEEAWKIRKELD
EETERRRQLENEVKSTQEEIWTLRNQGPQESVVRKEVLKKVPDPVLEESF
QQLQRTLAEEQHKNQLLQEELEALQLQLRALEQETRDGGQEYVVKEVLRI
EPDRAQADEVLQLREELEALRRQKGAREAEVLLLQQRVAALAEEKSRAQE
KVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSFLQDKLKR
LEKERAMAEGKITVKEVLKVEKDAATEREVSDLTRQYEDEAAKARASQRE
KTELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEVANLRLELVEQER
KYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKELQR
LREEIVDKTRLIERCDLEIYQLKKEIQALKDTKPQVQTKEVVQEILQFQE
DPQTKEEVASLRAKLSEEQKKQVDLERERASQEEQIARKEEELSRVKERV
VQQEVVRYEEEPGLRAEASAFAESIDVELRQIDKLRAELRRLQRRRTELE
RQLEELERERQARREAEREVQRLQQRLAALEQEEAEAREKVTHTQKVVLQ
QDPQQAREHALLRLQLEEEQHRRQLLEGELETLRRKLAALEKAEVKEKVV
LSESVQVEKGDTEQEIQRLKSSLEEESRSKRELDVEVSRLEARLSELEFH
NSKSSKELDFLREENHKLQLERQNLQLETRRLQSEINMAATETRDLRNMT
VADSGTNHDSRLWSLERELDDLKRLSKDKDLEIDELQKRLGSVAVKREQR
ENHLRRSIVVIHPDTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISV
KGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVNKDMSIQELAV
LVSGQK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як кератинізація. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані, мітохондрії, клітинних контактах.

Література[ред. | ред. код]

  • Ruhrberg C., Hajibagheri M.A.N., Parry D.A.D., Watt F.M. (1997). Periplakin, a novel component of cornified envelopes and desmosomes that belongs to the plakin family and forms complexes with envoplakin.. J. Cell Biol. 139: 1835 — 1849.  PubMed DOI:10.1083/jcb.139.7.1835
  • Aho S., McLean W.H.I., Li K., Uitto J. (1998). cDNA cloning, mRNA expression, and chromosomal mapping of human and mouse periplakin genes.. Genomics 48: 242 — 247.  PubMed DOI:10.1006/geno.1997.5188
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beekman J.M., Bakema J.E., van de Winkel J.G.J., Leusen J.H.W. (2004). Direct interaction between FcgammaRI (CD64) and periplakin controls receptor endocytosis and ligand binding capacity.. Proc. Natl. Acad. Sci. U.S.A. 101: 10392 — 10397.  PubMed DOI:10.1073/pnas.0401217101

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9273 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, O60437 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]