MYL12B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYL12B
Ідентифікатори
Символи MYL12B, MLC-B, MRLC2, myosin light chain 12B
Зовнішні ІД OMIM: 609211 MGI: 1914518 HomoloGene: 68515 GeneCards: MYL12B
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_033546
NM_001144944
NM_001144945
NM_001144946
NM_026064
NM_001357820
RefSeq (білок)
NP_001138416
NP_001138417
NP_291024
н/д
Локус (UCSC) Хр. 18: 3.26 – 3.28 Mb Хр. 17: 70.99 – 71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYL12B (англ. Myosin light chain 12A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 172 амінокислот, а молекулярна маса — 19 779[4].

Послідовність амінокислот
1020304050
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFID
KEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPE
DVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDK
KGNFNYIEFTRILKHGAKDKDD

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків, фосфопротеїнів. Білок має сайт для зв'язування з іонами металів, іоном кальцію.

Література[ред. | ред. код]

  • Iwasaki T., Murata-Hori M., Ishitobi S., Hosoya H. (2001). Diphosphorylated MRLC is required for organization of stress fibers in interphase cells and the contractile ring in dividing cells.. Cell Struct. Funct. 26: 677 — 683.  PubMed DOI:10.1247/csf.26.677
  • Watanabe M., Kohri M., Takaishi M., Horie R., Higashihara M. (2001). Molecular cloning and sequencing of myosin light chains in human megakaryoblastic leukemia cells.. J. Smooth Muscle Res. 37: 25 — 38.  PubMed DOI:10.1540/jsmr.37.25
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Suizu F., Ueda K., Iwasaki T., Murata-Hori M., Hosoya H. (2000). Activation of actin-activated MgATPase activity of myosin II by phosphorylation with MAPK-activated protein kinase-1b (RSK-2).. J. Biochem. 128: 435 — 440.  PubMed DOI:10.1093/oxfordjournals.jbchem.a022771
  • Fumoto K., Uchimura T., Iwasaki T., Ueda K., Hosoya H. (2003). Phosphorylation of myosin II regulatory light chain is necessary for migration of HeLa cells but not for localization of myosin II at the leading edge.. Biochem. J. 370: 551 — 556.  PubMed DOI:10.1042/BJ20021559
  • Umeda D., Tachibana H., Yamada K. (2005). Epigallocatechin-3-O-gallate disrupts stress fibers and the contractile ring by reducing myosin regulatory light chain phosphorylation mediated through the target molecule 67 kDa laminin receptor.. Biochem. Biophys. Res. Commun. 333: 628 — 635.  PubMed DOI:10.1016/j.bbrc.2005.05.108

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:29827 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O14950 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]