Легкий ланцюг міозину 6B

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з MYL6B)
Перейти до навігації Перейти до пошуку
Легкий ланцюг міозину 6B
Protein MYL6B PDB 1oe9.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYL6B, MLC1SA, myosin light chain 6B
Зовнішні ІД OMIM: 609930 MGI: 1917789 HomoloGene: 86887 GeneCards: MYL6B
Шаблон експресії
PBB GE MYL6B 204173 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002475
NM_001199629
NM_172259
RefSeq (білок)
NP_001186558
NP_002466
NP_758463
Локус (UCSC) Хр. 12: 56.15 – 56.16 Mb Хр. 10: 128.49 – 128.5 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Легкий ланцюг міозину 6B (англ. Myosin light chain 6B) – білок, який кодується геном MYL6B, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 208 амінокислот, а молекулярна маса — 22 764[4].

Послідовність амінокислот
1020304050
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEP
PVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNP
TNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGF
RVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEA
FLKHILSV

Цей білок за функціями належить до білкових моторів, міозинів, м'язових білків.

Література[ред. | ред. код]

  • Hailstones D.L., Gunning P.W. (1990). Characterization of human myosin light chains 1sa and 3nm: implications for isoform evolution and function.. Mol. Cell. Biol. 10: 1095 — 1104.  PubMed DOI:10.1128/MCB.10.3.1095
  • Zimmermann K., Starzinski-Powitz A. (1989). A novel isoform of myosin alkali light chain isolated from human muscle cells.. Nucleic Acids Res. 17: 10496 — 10496.  PubMed DOI:10.1093/nar/17.24.10496
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:29823 (англ.). Процитовано 21 серпня 2017. 
  4. UniProt, P14649 (англ.). Процитовано 21 серпня 2017. 

Див. також[ред. | ред. код]