Кератин-6A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Кератин-6A
Ідентифікатори
Символи KRT6A, CK6A, CK6C, CK6D, K6A, K6C, K6D, KRT6C, KRT6D, PC3, CK-6C, CK-6E, keratin 6A
Зовнішні ІД OMIM: 148041 MGI: 1100845 HomoloGene: 36182 GeneCards: KRT6A
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005554
NM_008476
RefSeq (білок)
NP_005545
NP_032502
Локус (UCSC) Хр. 12: 52.49 – 52.49 Mb Хр. 15: 101.69 – 101.69 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-6A (англ. Keratin 6A) – білок, який кодується геном KRT6A, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 564 амінокислот, а молекулярна маса — 60 045[4].

Послідовність амінокислот
1020304050
MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGA
CGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF
GFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNL
QIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWTLLQE
QGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFK
NKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA
LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA
EAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKK
QCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQE
LMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGA
SGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIK
YTTTSSSSRKSYKH

Література[ред. | ред. код]

  • Takahashi K., Paladini R.D., Coulombe P.A. (1995). Cloning and characterization of multiple human genes and cDNAs encoding highly related type II keratin 6 isoforms.. J. Biol. Chem. 270: 18581 — 18592.  PubMed DOI:10.1074/jbc.270.31.18581
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hanukoglu I., Fuchs E. (1983). The cDNA sequence of a type II cytoskeletal keratin reveals constant and variable structural domains among keratins.. Cell 33: 915 — 924.  PubMed DOI:10.1016/0092-8674(83)90034-X
  • Garcia-Rio I., Penas P.F., Garcia-Diez A., McLean W.H., Smith F.J. (2005). A severe case of pachyonychia congenita type I due to a novel proline mutation in keratin 6a.. Br. J. Dermatol. 152: 800 — 802.  PubMed DOI:10.1111/j.1365-2133.2005.06473.x

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6443 (англ.). Процитовано 21 серпня 2017. 
  4. UniProt, P02538 (англ.). Процитовано 21 серпня 2017. 

Див. також[ред. | ред. код]