KRT37

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT37
Ідентифікатори
Символи KRT37, HA7, K37, KRTHA7, keratin 37
Зовнішні ІД OMIM: 604541 HomoloGene: 122145 GeneCards: KRT37
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003770
н/д
RefSeq (білок)
NP_003761
н/д
Локус (UCSC) Хр. 17: 41.42 – 41.42 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

KRT37 (англ. Keratin 37) – білок, який кодується однойменним геном, розташованим у людей на довгому плечі 17-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 449 амінокислот, а молекулярна маса — 49 747[3].

Послідовність амінокислот
1020304050
MTSFYSTSSCPLGCTMAPGARNVFVSPIDVGCQPVAEANAASMCLLANVA
HANRVRVGSTPLGRPSLCLPPTSHTACPLPGTCHIPGNIGICGAYGKNTL
NGHEKETMKFLNDRLANYLEKVRQLEQENAELETTLLERSKCHESTVCPD
YQSYFRTIEELQQKILCSKAENARLIVQIDNAKLAADDFRIKLESERSLH
QLVEADKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKSNHEQEVKILR
SQLGEKFRIELDIEPTIDLNRVLGEMRAQYEAMVETNHQDVEQWFQAQSE
GISLQAMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCE
AEDRYGTELAQMQSLISNLEEQLSEIRADLERQNQEYQVLLDVKARLENE
IATYRNLLESEDCKLPCNPCSTPASCTSCPSCGPVTGGSPSGHGASMGR

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J. (1998). Characterization of a 190-kilobase pair domain of human type I hair keratin genes.. J. Biol. Chem. 273: 26683 — 26691.  PubMed DOI:10.1074/jbc.273.41.26683

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:6455 (англ.). Процитовано 21 вересня 2017. 
  3. UniProt, O76014 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]