MYO1E

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYO1E
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYO1E, FSGS6, HuncM-IC, MYO1C, myosin IE
Зовнішні ІД OMIM: 601479 MGI: 106621 HomoloGene: 55864 GeneCards: MYO1E
Пов'язані генетичні захворювання
focal segmental glomerulosclerosis 6[1]
Шаблон експресії
PBB GE MYO1E 203072 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004998
NM_181072
RefSeq (білок)
NP_004989
NP_851417
Локус (UCSC) Хр. 15: 59.13 – 59.37 Mb Хр. 9: 70.21 – 70.4 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYO1E (англ. Myosin IE) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 108 амінокислот, а молекулярна маса — 127 062[5].

Послідовність амінокислот
1020304050
MGSKGVYQYHWQSHNVKHSGVDDMVLLSKITENSIVENLKKRYMDDYIFT
YIGSVLISVNPFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMYRNMI
IDRENQCVIISGESGAGKTVAAKYIMSYISRVSGGGTKVQHVKDIILQSN
PLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVV
MRNPGERSFHIFYQLIEGASAEQKHSLGITSMDYYYYLSLSGSYKVDDID
DRREFQETLHAMNVIGIFAEEQTLVLQIVAGILHLGNISFKEVGNYAAVE
SEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACY
TRDALAKALHARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGF
EQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLI
ENKVNPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIGSHEHFNSWNQ
GFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELPFIKSLFPENL
QADKKGRPTTAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEE
SRVKHQVEYLGLKENIRVRRAGYAYRRIFQKFLQRYAILTKATWPSWQGE
EKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYAR
VIQKSWRKFVARKKYVQMREEASDLLLNKKERRRNSINRNFIGDYIGMEE
HPELQQFVGKREKIDFADTVTKYDRRFKGVKRDLLLTPKCLYLIGREKVK
QGPDKGLVKEVLKRKIEIERILSVSLSTMQDDIFILHEQEYDSLLESVFK
TEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFH
QGFGDLAVLKPSNKVLQVSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANY
PVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQ
QSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPK
PQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLF
PNNYVTKI

Кодований геном білок за функціями належить до білкових моторів, міозинів, фосфопротеїнів. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну, ліпідами. Локалізований у цитоплазмі, цитоскелеті, клітинних контактах, цитоплазматичних везикулах.

Література[ред. | ред. код]

  • Bement W.M., Wirth J.A., Mooseker M.S. (1994). Cloning and mRNA expression of human unconventional myosin-IC. A homologue of amoeboid myosins-I with a single IQ motif and an SH3 domain.. J. Mol. Biol. 243: 356 — 363.  PubMed DOI:10.1006/jmbi.1994.1662
  • Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S. (1994). Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types.. Proc. Natl. Acad. Sci. U.S.A. 91: 6549 — 6553.  PubMed DOI:10.1073/pnas.91.14.6549
  • Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S. (1994). Proc. Natl. Acad. Sci. U.S.A. 91: 11767 — 11767.  PubMed DOI:10.1073/pnas.91.24.11767c
  • El Mezgueldi M., Tang N., Rosenfeld S.S., Ostap E.M. (2002). The kinetic mechanism of Myo1e (human myosin-IC).. J. Biol. Chem. 277: 21514 — 21521.  PubMed DOI:10.1074/jbc.M200713200
  • Krendel M., Osterweil E.K., Mooseker M.S. (2007). Myosin 1E interacts with synaptojanin-1 and dynamin and is involved in endocytosis.. FEBS Lett. 581: 644 — 650.  PubMed DOI:10.1016/j.febslet.2007.01.021
  • Liang Y., Niederstrasser H., Edwards M., Jackson C.E., Cooper J.A. (2009). Distinct roles for CARMIL isoforms in cell migration.. Mol. Biol. Cell 20: 5290 — 5305.  PubMed DOI:10.1091/mbc.E08-10-1071

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]