MYO1C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYO1C
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYO1C, MMI-beta, MMIb, NMI, myr2, myosin IC
Зовнішні ІД OMIM: 606538 MGI: 106612 HomoloGene: 32046 GeneCards: MYO1C
Шаблон експресії
PBB GE MYO1C 32811 at fs.png

PBB GE MYO1C 214656 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_033375
NM_001080779
NM_001080950
NM_001363855
NM_001080774
NM_001080775
NM_008659
NM_001370611
RefSeq (білок)
NP_001074248
NP_001074419
NP_203693
NP_001350784
NP_001074243
NP_001074244
NP_032685
NP_001357540
Локус (UCSC) Хр. 17: 1.46 – 1.49 Mb Хр. 11: 75.65 – 75.67 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYO1C (англ. Myosin IC) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 063 амінокислот, а молекулярна маса — 121 682[4].

Послідовність амінокислот
1020304050
MALQVELVPTGEIIRVVHPHRPCKLALGSDGVRVTMESALTARDRVGVQD
FVLLENFTSEAAFIENLRRRFRENLIYTYIGPVLVSVNPYRDLQIYSRQH
MERYRGVSFYEVPPHLFAVADTVYRALRTERRDQAVMISGESGAGKTEAT
KRLLQFYAETCPAPERGGAVRDRLLQSNPVLEAFGNAKTLRNDNSSRFGK
YMDVQFDFKGAPVGGHILSYLLEKSRVVHQNHGERNFHIFYQLLEGGEEE
TLRRLGLERNPQSYLYLVKGQCAKVSSINDKSDWKVVRKALTVIDFTEDE
VEDLLSIVASVLHLGNIHFAANEESNAQVTTENQLKYLTRLLSVEGSTLR
EALTHRKIIAKGEELLSPLNLEQAAYARDALAKAVYSRTFTWLVGKINRS
LASKDVESPSWRSTTVLGLLDIYGFEVFQHNSFEQFCINYCNEKLQQLFI
ELTLKSEQEEYEAEGIAWEPVQYFNNKIICDLVEEKFKGIISILDEECLR
PGEATDLTFLEKLEDTVKHHPHFLTHKLADQRTRKSLGRGEFRLLHYAGE
VTYSVTGFLDKNNDLLFRNLKETMCSSKNPIMSQCFDRSELSDKKRPETV
ATQFKMSLLQLVEILQSKEPAYVRCIKPNDAKQPGRFDEVLIRHQVKYLG
LLENLRVRRAGFAYRRKYEAFLQRYKSLCPETWPTWAGRPQDGVAVLVRH
LGYKPEEYKMGRTKIFIRFPKTLFATEDALEVRRQSLATKIQAAWRGFHW
RQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFVLRHAP
RCPENAFFLDHVRTSFLLNLRRQLPQNVLDTSWPTPPPALREASELLREL
CIKNMVWKYCRSISPEWKQQLQQKAVASEIFKGKKDNYPQSVPRLFISTR
LGTDEISPRVLQALGSEPIQYAVPVVKYDRKGYKPRSRQLLLTPNAVVIV
EDAKVKQRIDYANLTGISVSSLSDSLFVLHVQRADNKQKGDVVLQSDHVI
ETLTKTALSANRVNSININQGSITFAGGPGRDGTIDFTPGSELLITKAKN
GHLAVVAPRLNSR

Кодований геном білок за функціями належить до білкових моторів, міозинів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, транспорт білків, транспорт мРНК, транслокація, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані, клітинних відростках, цитоплазматичних везикулах, комплексі ядерної пори.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cisterna B., Necchi D., Prosperi E., Biggiogera M. (2006). Small ribosomal subunits associate with nuclear myosin and actin in transit to the nuclear pores.. FASEB J. 20: 1901 — 1903.  PubMed DOI:10.1096/fj.05-5278fje
  • Cavellan E., Asp P., Percipalle P., Oestlund Farrants A.-K. (2006). The WSTF-SNF2h chromatin remodeling complex interacts with several nuclear proteins in transcription.. J. Biol. Chem. 281: 16264 — 16271.  PubMed DOI:10.1074/jbc.M600233200
  • Ihnatovych I., Migocka-Patrzalek M., Dukh M., Hofmann W.A. (2012). Identification and characterization of a novel myosin Ic isoform that localizes to the nucleus.. Cytoskeleton 69: 555 — 565.  PubMed DOI:10.1002/cm.21040
  • Stefan Munnich M.H., Manstein D.J. (2014). Crystal structure of human myosin 1c - the motor in GLUT4 exocytosis: implications for Ca(2+)-regulation and 14-3-3 binding.. J. Mol. Biol. 426: 2070 — 2081.  PubMed DOI:10.1016/j.jmb.2014.03.004

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7597 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O00159 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]