MYL3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYL3
Ідентифікатори
Символи MYL3, CMH8, MLC1SB, MLC1V, VLC1, MLC-lV/sb, VLCl, myosin light chain 3
Зовнішні ІД OMIM: 160790 MGI: 97268 HomoloGene: 20099 GeneCards: MYL3
Пов'язані генетичні захворювання
hypertrophic cardiomyopathy 8[1]
Шаблон експресії
PBB GE MYL3 205589 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000258
NM_010859
NM_001364484
RefSeq (білок)
NP_000249
NP_000249.1
NP_034989
NP_001351413
Локус (UCSC) Хр. 3: 46.84 – 46.88 Mb Хр. 9: 110.74 – 110.77 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYL3 (англ. Myosin light chain 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 195 амінокислот, а молекулярна маса — 21 932[5].

Послідовність амінокислот
1020304050
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQ
IEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPR
QEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMG
AELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків, фосфопротеїнів.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Henry G.D., Trayer I.P., Brewer S., Levine B.A. (1985). The widespread distribution of alpha-N-trimethylalanine as the N-terminal amino acid of light chains from vertebrate striated muscle myosins.. Eur. J. Biochem. 148: 75 — 82.  PubMed DOI:10.1111/j.1432-1033.1985.tb08809.x
  • Olson T.M., Karst M.L., Whitby F.G., Driscoll D.J. (2002). Myosin light chain mutation causes autosomal recessive cardiomyopathy with mid-cavitary hypertrophy and restrictive physiology.. Circulation 105: 2337 — 2340.  PubMed DOI:10.1161/01.CIR.0000018444.47798.94
  • Jay A., Chikarmane R., Poulik J., Misra V.K. (2013). Infantile hypertrophic cardiomyopathy associated with a novel MYL3 mutation.. Cardiology 124: 248 — 251.  PubMed DOI:10.1159/000347138
  • Kurabayashi M., Komuro I., Tsuchimochi H., Takaku F., Yazaki Y. (1988). Molecular cloning and characterization of human atrial and ventricular myosin alkali light chain cDNA clones.. J. Biol. Chem. 263: 13930 — 13936.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]