DNM2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DNM2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DNM2, CMT2M, CMTDI1, CMTDIB, DI-CMTB, DYN2, DYNII, LCCS5, dynamin 2
Зовнішні ІД OMIM: 602378 MGI: 109547 HomoloGene: 90883 GeneCards: DNM2
Пов'язані генетичні захворювання
Ішемічна хвороба серця, fetal akinesia-cerebral and retinal hemorrhage syndrome[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004945
NM_001005360
NM_001005361
NM_001005362
NM_001190716
RefSeq (білок)
NP_001005360
NP_001005361
NP_001005362
NP_001177645
NP_004936
Локус (UCSC) Хр. 19: 10.72 – 10.83 Mb Хр. 9: 21.42 – 21.51 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DNM2 (англ. Dynamin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 870 амінокислот, а молекулярна маса — 98 064[5].

Послідовність амінокислот
1020304050
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLEN
FVGRDFLPRGSGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQE
IEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPP
DIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRT
IGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRA
ALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQ
VDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRT
GLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELINTVRQCTSKLSSYP
RLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANAQ
QRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESL
SWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDL
RQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLE
RQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLY
SSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPP
PVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGA
AASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRR
PPAAPSRPTIIRPAEPSLLD

Кодований геном білок за функціями належить до білкових моторів, гідролаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як ендоцитоз, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клатрин-вкритих заглибинах мембрани, клітинних контактах, клітинних відростках, цитоплазматичних везикулах, синапсах.

Література[ред. | ред. код]

  • Diatloff-Zito C., Gordon A.J.E., Duchaud E., Merlin G. (1995). Isolation of an ubiquitously expressed cDNA encoding human dynamin II, a member of the large GTP-binding protein family.. Gene 163: 301 — 306.  PubMed DOI:10.1016/0378-1119(95)00275-B
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Okamoto P.M., Gamby C., Wells D., Fallon J., Vallee R.B. (2001). Dynamin isoform-specific interaction with the shank/ProSAP scaffolding proteins of the postsynaptic density and actin cytoskeleton.. J. Biol. Chem. 276: 48458 — 48465.  PubMed DOI:10.1074/jbc.M104927200
  • Thompson H.M., Skop A.R., Euteneuer U., Meyer B.J., McNiven M.A. (2002). The large GTPase dynamin associates with the spindle midzone and is required for cytokinesis.. Curr. Biol. 12: 2111 — 2117.  PubMed DOI:10.1016/S0960-9822(02)01390-8
  • Soulet F., Yarar D., Leonard M., Schmid S.L. (2005). SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.. Mol. Biol. Cell 16: 2058 — 2067.  PubMed DOI:10.1091/mbc.E04-11-1016
  • Krendel M., Osterweil E.K., Mooseker M.S. (2007). Myosin 1E interacts with synaptojanin-1 and dynamin and is involved in endocytosis.. FEBS Lett. 581: 644 — 650.  PubMed DOI:10.1016/j.febslet.2007.01.021

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]