Десмоплакін

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Desmoplakin
Ідентифікатори
Символи 250/210 kDa paraneoplastic pemphigus antigenDSPdesmoplakin
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE DSP 200606 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

Десмоплакін (англ. Desmoplakin) – білок, який кодується геном DSP, розташованим у людей на короткому плечі 6-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 2 871 амінокислот, а молекулярна маса — 331 774[2].

Послідовність амінокислот
1020304050
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITD
QNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQ
LTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMR
ALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRA
EMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQ
LEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD
KNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAY
MDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIR
KKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKP
RNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGG
VDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSW
HYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMF
GDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVN
HNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSH
HITVKINELKSVQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLF
QKLENINGVTDGYLNSLCTVRALLQAILQTEDMLKVYEARLTEEETVCLD
LDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHSQTSQQYPLYD
LDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCK
WLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKI
AELCANSIKDYELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVH
ARYIELLTRSGDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSE
NCNKNKFLDQNLQKYQAECSQFKAKLASLEELKRQAELDGKSAKQNLDKC
YGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKARQCEK
ENLGWQKLESEKAIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYN
EEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLK
DEIVRLNDSILQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQ
QRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEFQEEAKRRWEYENELSK
VRNNYDEEIISLKNQFETEINITKTTIHQLTMQKEEDTSGYRAQIDNLTR
ENRSLSEEIKRLKNTLTQTTENLRRVEEDIQQQKATGSEVSQRKQQLEVE
LRQVTQMRTEESVRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCL
EDENARLQRVQYDLQKANSSATETINKLKVQEQELTRLRIDYERVSQERT
VKDQDITRFQNSLKELQLQKQKVEEELNRLKRTASEDSCKRKKLEEELEG
MRRSLKEQAIKITNLTQQLEQASIVKKRSEDDLRQQRDVLDGHLREKQRT
QEELRRLSSEVEALRRQLLQEQESVKQAHLRNEHFQKAIEDKSRSLNESK
IEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEADSDKNATIL
ELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQE
SKNQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKSTLEAETRVK
QRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIE
RLQAEIKRIEERCRRKLEDSTRETQSQLETERSRYQREIDKLRQRPYGSH
RETQTECEWTVDTSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLKGKKS
VEEVASEIQPFLRGAGSIAGASASPKEKYSLVEAKRKKLISPESTVMLLE
AQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAEKAITGFDDPF
SGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALA
RGLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLL
LSVQKRSMSFQGIRQPVTVTELVDSGILRPSTVNELESGQISYDEVGERI
KDFLQGSSCIAGIYNETTKQKLGIYEAMKIGLVRPGTALELLEAQAATGF
IVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYNDPETGNIISL
FQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEE
LSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKK
KQVQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQE
CEWEEITITGSDGSTRVVLVDRKTGSQYDIQDAIDKGLVDRKFFDQYRSG
SLSLTQFADMISLKNGVGTSSSMGSGVSDDVFSSSRHESVSKISTISSVR
NLTIRSSSFSDTLEESSPIAAIFDTENLEKISITEGIERGIVDSITGQRL
LEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAFIGFEG
VKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEA
IRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGL
RLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSF
DATGNSSYSYSYSFSSSSIGH

Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах.

Література[ред. | ред. код]

  • Virata M.L.A., Wagner R.M., Parry D.A.D., Green K.J. (1992). Molecular structure of the human desmoplakin I and II amino terminus.. Proc. Natl. Acad. Sci. U.S.A. 89: 544 — 548.  PubMed DOI:10.1073/pnas.89.2.544
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Marekov L.N., Steinert P.M. (1998). Ceramides are bound to structural proteins of the human foreskin epidermal cornified cell envelope.. J. Biol. Chem. 273: 17763 — 17770.  PubMed DOI:10.1074/jbc.273.28.17763
  • Koster J., Geerts D., Favre B., Borradori L., Sonnenberg A. (2003). Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly.. J. Cell Sci. 116: 387 — 399.  PubMed DOI:10.1242/jcs.00241
  • Choi H.J., Park-Snyder S., Pascoe L.T., Green K.J., Weis W.I. (2002). Structures of two intermediate filament-binding fragments of desmoplakin reveal a unique repeat motif structure.. Nat. Struct. Biol. 9: 612 — 620.  PubMed DOI:10.1038/nsb818
  • Choi H.J., Weis W.I. (2011). Crystal structure of a rigid four-spectrin-repeat fragment of the human desmoplakin plakin domain.. J. Mol. Biol. 409: 800 — 812.  PubMed DOI:10.1016/j.jmb.2011.04.046

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:3052 (англ.). Процитовано 27 лютого 2017. 
  2. UniProt, P15924 (англ.). Процитовано 27 лютого 2017. 

Див. також[ред. | ред. код]