TUBA1A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TUBA1A
Protein TUBA1A PDB 1ffx.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TUBA1A, B-ALPHA-1, LIS3, TUBA3, tubulin alpha 1a
Зовнішні ІД OMIM: 602529 MGI: 98869 HomoloGene: 68498 GeneCards: TUBA1A
Шаблон експресії
PBB GE TUBA1A 209251 x at fs.png

PBB GE TUBA1A 209118 s at fs.png

PBB GE TUBA1A 201090 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006009
NM_001270399
NM_001270400
NM_011653
RefSeq (білок)
NP_001257328
NP_001257329
NP_006000
NP_035783
Локус (UCSC) Хр. 12: 49.18 – 49.19 Mb Хр. 15: 98.95 – 98.95 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TUBA1A (англ. Tubulin alpha 1a) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 451 амінокислот, а молекулярна маса — 50 136[4].

Послідовність амінокислот
1020304050
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN
TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA
NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT
SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC
AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV
DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE
Y

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Hall J.L., Cowan N.J. (1985). Structural features and restricted expression of a human alpha-tubulin gene.. Nucleic Acids Res. 13: 207 — 223.  PubMed DOI:10.1093/nar/13.1.207
  • Crabtree D.V., Ojima I., Geng X., Adler A.J. (2001). Tubulins in the primate retina: evidence that xanthophylls may be endogenous ligands for the paclitaxel-binding site.. Bioorg. Med. Chem. 9: 1967 — 1976.  PubMed DOI:10.1016/S0968-0896(01)00103-1
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cowan N.J., Dobner P., Fuchs E.V., Cleveland D.W. (1983). Expression of human alpha-tubulin genes: interspecies conservation of 3' untranslated regions.. Mol. Cell. Biol. 3: 1738 — 1745.  PubMed DOI:10.1128/MCB.3.10.1738
  • Valenstein M.L., Roll-Mecak A. (2016). Graded control of microtubule severing by tubulin glutamylation.. Cell 164: 911 — 921.  PubMed DOI:10.1016/j.cell.2016.01.019
  • Nirschl J.J., Magiera M.M., Lazarus J.E., Janke C., Holzbaur E.L. (2016). Alpha-tubulin tyrosination and CLIP-170 phosphorylation regulate the initiation of dynein-driven transport in neurons.. Cell Rep. 14: 2637 — 2652.  PubMed DOI:10.1016/j.celrep.2016.02.046

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:20766 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q71U36 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]