KIF5B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF5B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF5B, HEL-S-61, KINH, KNS, KNS1, UKHC, kinesin family member 5B
Зовнішні ІД OMIM: 602809 MGI: 1098268 HomoloGene: 55829 GeneCards: KIF5B
Пов'язані генетичні захворювання
Біполярний афективний розлад[1]
Шаблон експресії
PBB GE KIF5B 201991 s at fs.png

PBB GE KIF5B 201992 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004521
NM_008448
RefSeq (білок)
NP_004512
NP_032474
Локус (UCSC) Хр. 10: 32.01 – 32.06 Mb Хр. 18: 6.2 – 6.24 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF5B (англ. Kinesin family member 5B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 963 амінокислот, а молекулярна маса — 109 685[5].

Послідовність амінокислот
1020304050
MADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDR
VFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLH
DPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSK
TNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEH
SSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDE
AKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEK
NKILRNTIQWLENELNRWRNGETVPIDEQFDKEKANLEAFTVDKDITLTN
DKPATAIGVIGNFTDAERRKCEEEIAKLYKQLDDKDEEINQQSQLVEKLK
TQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAV
NYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKR
AAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYL
QNVEQKKRQLEESVDALSEELVQLRAQEKVHEMEKEHLNKVQTANEVKQA
VEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLEQERLRVE
HEKLKATDQEKSRKLHELTVMQDRREQARQDLKGLEETVAKELQTLHNLR
KLFVQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLEQLTKVHKQLV
RDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNS
QPVAVRGGGGKQV

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Su Q., Cai Q., Gerwin C., Smith C.L., Sheng Z.-H. (2004). Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons.. Nat. Cell Biol. 6: 941 — 953.  PubMed DOI:10.1038/ncb1169
  • Boucrot E., Henry T., Borg J.-P., Gorvel J.-P., Meresse S. (2005). The intracellular fate of Salmonella depends on the recruitment of kinesin.. Science 308: 1174 — 1178.  PubMed DOI:10.1126/science.1110225
  • Kull F.J., Sablin E.P., Lau R., Fletterick R.J., Vale R.D. (1996). Crystal structure of the kinesin motor domain reveals a structural similarity to myosin.. Nature 380: 550 — 555.  PubMed DOI:10.1038/380550a0
  • Sindelar C.V., Downing K.H. (2007). The beginning of kinesin's force-generating cycle visualized at 9-A resolution.. J. Cell Biol. 177: 377 — 385.  PubMed DOI:10.1083/jcb.200612090

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]