Серцевий альфа-актин-1

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з ACTC1)
Перейти до навігації Перейти до пошуку
Серцевий альфа-актин-1
Protein ACTC1 PDB 1atn.png
Ідентифікатори
Символи ACTC1, ACTC, ASD5, CMD1R, CMH11, LVNC4, actin, alpha, cardiac muscle 1, actin alpha cardiac muscle 1
Зовнішні ІД OMIM: 102540 MGI: 87905 HomoloGene: 68446 GeneCards: ACTC1
Пов'язані генетичні захворювання
dilated cardiomyopathy 1R, hypertrophic cardiomyopathy 11, atrial heart septal defect 5, X-linked cerebral adrenoleukodystrophy[1]
Шаблон експресії
PBB GE ACTC1 205132 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005159
NM_009608
RefSeq (білок)
NP_005150
NP_033738
Локус (UCSC) Хр. 15: 34.79 – 34.8 Mb Хр. 2: 114.05 – 114.05 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Серцевий альфа-актин-1 (англ. Actin, alpha, cardiac muscle 1) – білок, який кодується геном ACTC1, розташованим у людей на короткому плечі 15-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 377 амінокислот, а молекулярна маса — 42 019[5].

Послідовність амінокислот
1020304050
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG
QKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAP
EEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRT
TGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGY
SFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVI
TIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS
LSTFQQMWISKQEYDEAGPSIVHRKCF

Цей білок за функцією належить до м'язових білків. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Hamada H., Petrino M.G., Kakunaga T. (1982). Molecular structure and evolutionary origin of human cardiac muscle actin gene.. Proc. Natl. Acad. Sci. U.S.A. 79: 5901 — 5905.  PubMed DOI:10.1073/pnas.79.19.5901
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Olson T.M., Michels V.V., Thibodeau S.N., Tai Y.-S., Keating M.T. (1998). Actin mutations in dilated cardiomyopathy, a heritable form of heart failure.. Science 280: 750 — 752.  PubMed DOI:10.1126/science.280.5364.750

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]