Альфа-катенін 1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Альфа-катенін 1
Protein CTNNA1 PDB 1dov.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CTNNA1, CAP102, Catenin, MDPT2, catenin alpha 1
Зовнішні ІД OMIM: 116805 MGI: 88274 HomoloGene: 1433 GeneCards: CTNNA1
Пов'язані генетичні захворювання
patterned macular dystrophy 2[1]
Шаблон експресії
PBB GE CTNNA1 210844 x at fs.png

PBB GE CTNNA1 200764 s at fs.png

PBB GE CTNNA1 200765 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_009818
RefSeq (білок)
NP_033948
Локус (UCSC) Хр. 5: 138.61 – 138.94 Mb Хр. 18: 35.12 – 35.25 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Альфа-катенін 1 (англ. Catenin alpha 1) – білок, який кодується геном CTNNA1, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 906 амінокислот, а молекулярна маса — 100 071[5].

Послідовність амінокислот
1020304050
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNK
KRGRSKKAHVLAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQ
GDLMKAAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKL
LVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKD
VGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQ
AVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSE
YMGNAGRKERSDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVP
LLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLV
RMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTD
AVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAA
RVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDV
RSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDA
EVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIA
EAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEV
QNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMA
SLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI

Задіяний у такому біологічному процесі як клітинна адгезія. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах.

Література[ред. | ред. код]

  • Rimm D.L., Kebriaei P., Morrow J.S. (1994). Molecular cloning reveals alternative splice forms of human alpha(E)-catenin.. Biochem. Biophys. Res. Commun. 203: 1691 — 1699.  PubMed DOI:10.1006/bbrc.1994.2381
  • Kask M., Pruunsild P., Timmusk T. (2011). Bidirectional transcription from human LRRTM2/CTNNA1 and LRRTM1/CTNNA2 gene loci leads to expression of N-terminally truncated CTNNA1 and CTNNA2 isoforms.. Biochem. Biophys. Res. Commun. 411: 56 — 61.  PubMed DOI:10.1016/j.bbrc.2011.06.085
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Butz S., Kemler R. (1994). Distinct cadherin-catenin complexes in Ca(2+)-dependent cell-cell adhesion.. FEBS Lett. 355: 195 — 200.  PubMed DOI:10.1016/0014-5793(94)01205-9
  • Koslov E.R., Maupin P., Pradhan D., Morrow J.S., Rimm D.L. (1997). Alpha-catenin can form asymmetric homodimeric complexes and/or heterodimeric complexes with beta-catenin.. J. Biol. Chem. 272: 27301 — 27306.  PubMed DOI:10.1074/jbc.272.43.27301
  • Gocke C.B., Yu H., Kang J. (2005). Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.. J. Biol. Chem. 280: 5004 — 5012.  PubMed DOI:10.1074/jbc.M411718200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]