DYNC1LI2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DYNC1LI2
Ідентифікатори
Символи DYNC1LI2, DNCLI2, LIC2, dynein cytoplasmic 1 light intermediate chain 2
Зовнішні ІД OMIM: 611406 MGI: 107738 HomoloGene: 4474 GeneCards: DYNC1LI2
Шаблон експресії
PBB GE DYNC1LI2 203590 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001286157
NM_006141
NM_001323955
NM_001013380
RefSeq (білок)
NP_001273086
NP_001310884
NP_006132
NP_006132.1
NP_001013398
Локус (UCSC) Хр. 16: 66.72 – 66.75 Mb Хр. 8: 104.42 – 104.44 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DYNC1LI2 (англ. Dynein cytoplasmic 1 light intermediate chain 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 492 амінокислот, а молекулярна маса — 54 099[4].

Послідовність амінокислот
1020304050
MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSK
LPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDD
HTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQ
KWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGP
LTSGSDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEH
LDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPA
LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH
DKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGP
ASVPSSSPGTSVKKPDPNIKNNAASEGVLASFFNSLLSKKTGSPGSPGAG
GVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTENEA

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2966 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, O43237 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]