NEFH

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NEFH
Ідентифікатори
Символи NEFH, NFH, CMT2CC, neurofilament, heavy polypeptide, neurofilament heavy
Зовнішні ІД OMIM: 162230 MGI: 97309 HomoloGene: 40755 GeneCards: NEFH
Пов'язані генетичні захворювання
Charcot-Marie-Tooth disease axonal type 2CC[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021076
NM_010904
RefSeq (білок)
NP_066554
NP_035034
Локус (UCSC) Хр. 22: 29.48 – 29.49 Mb Хр. 11: 4.94 – 4.95 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NEFH (англ. Neurofilament heavy) – білок, який кодується однойменним геном, розташованим у людей на довгому плечі 22-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 026 амінокислот, а молекулярна маса — 112 479[5].

Послідовність амінокислот
1020304050
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSW
TRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQ
LQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQQAGRSAMGELYEREV
REMRGAVLRLGAARGQLRLEQEHLLEDIAHVRQRLDDEARQREEAEAAAR
ALARFAQEAEAARVDLQKKAQALQEECGYLRRHHQEEVGELLGQIQGSGA
AQAQMQAETRDALKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRL
SEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELE
DRHQADIASYQEAIQQLDAELRNTKWEMAAQLREYQDLLNVKMALDIEIA
AYRKLLEGEECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKS
EKETVIVEEQTEETQVTEEVTEEEEKEAKEEEGKEEEGGEEEEAEGGEEE
TKSPPAEEAASPEKEAKSPVKEEAKSPAEAKSPEKEEAKSPAEVKSPEKA
KSPAKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKS
PEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPE
KAKSPEKAKSPEKEEAKSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKA
KSPVKEEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKTPEKAKSPVKEEA
KSPEKAKSPEKAKTLDVKSPEAKTPAKEEARSPADKFPEKAKSPVKEEVK
SPEKAKSPLKEDAKAPEKEIPKKEEVKSPVKEEEKPQEVKVKEPPKKAEE
EKAPATPKTEEKKDSKKEEAPKKEAPKPKVEEKKEPAVEKPKESKVEAKK
EEAEDKKKVPTPEKEAPAKVEVKEDAKPKEKTEVAKKEPDDAKAKEPSKP
AEKKEAAPEKKDTKEEKAKKPEEKPKTEAKAKEDDKTLSKEPSKPKAEKA
EKSSSTDQKDSKPPEKATEDKAAKGK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у цитоплазмі, проміжних філаментах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lees J.F., Shneidman P.S., Skuntz S.F., Carden M.J., Lazzarini R.A. (1988). The structure and organization of the human heavy neurofilament subunit (NF-H) and the gene encoding it.. EMBO J. 7: 1947 — 1955.  PubMed
  • Zhu Y., Han Y. (1999). Molecular Cloning of human hSTE cDNA.. Beijing Yi Ke Da Xue Xue Bao 31: 531 — 531. 

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]