SPTBN5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SPTBN5
Ідентифікатори
Символи SPTBN5, BSPECV, HUBSPECV, HUSPECV, spectrin beta, non-erythrocytic 5
Зовнішні ІД OMIM: 605916 MGI: 2685200 HomoloGene: 41150 GeneCards: SPTBN5
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016642
NM_001370938
RefSeq (білок)
NP_057726
н/д
Локус (UCSC) Хр. 15: 41.85 – 41.89 Mb Хр. 2: 120.04 – 120.09 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SPTBN5 (англ. Spectrin beta, non-erythrocytic 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 3 674 амінокислот, а молекулярна маса — 416 750[4].

Послідовність амінокислот
1020304050
MAGQPHSPRELLGAAGHRSRRPSTELRVPPSPSLTMDSQYETGHIRKLQA
RHMQMQEKTFTKWINNVFQCGQAGIKIRNLYTELADGIHLLRLLELISGE
ALPPPSRGRLRVHFLENSSRALAFLRAKVPVPLIGPENIVDGDQTLILGL
IWVIILRFQISHISLDKEEFGASAALLSTKEALLVWCQRKTASYTNVNIT
DFSRSWSDGLGFNALIHAHRPDLLDYGSLRPDRPLHNLAFAFLVAEQELG
IAQLLDPEDVAAAQPDERSIMTYVSLYYHYCSRLHQGQTVQRRLTKILLQ
LQETELLQTQYEQLVADLLRWIAEKQMQLEARDFPDSLPAMRQLLAAFTI
FRTQEKPPRLQQRGAAEALLFRLQTALQAQNRRPFLPHEGLGLAELSQCW
AGLEWAEAARSQALQQRLLQLQRLETLARRFQHKAALRESFLKDAEQVLD
QARAPPASLATVEAAVQRLGMLEAGILPQEGRFQALAEIADILRQEQYHS
WADVARRQEEVTVRWQRLLQHLQGQRKQVADMQAVLSLLQEVEAASHQLE
ELQEPARSTACGQQLAEVVELLQRHDLLEAQVSAHGAHVSHLAQQTAELD
SSLGTSVEVLQAKARTLAQLQQSLVALVRARRALLEQTLQRAEFLRNCEE
EEAWLKECGQRVGNAALGRDLSQIAGALQKHKALEAEVHRHQAVCVDLVR
RGRDLSARRPPTQPDPGERAEAVQGGWQLLQTRVVGRGARLQTALLVLQY
FADAAEAASWLRERRSSLERASCGQDQAAAETLLRRHVRLERVLRAFAAE
LRRLEEQGRAASARASLFTVNSALSPPGESLRNPGPWSEASCHPGPGDAW
KMALPAEPDPDFDPNTILQTQDHLSQDYESLRALAQLRRARLEEAMALFG
FCSSCGELQLWLEKQTVLLQRVQPQADTLEVMQLKYENFLTALAVGKGLW
AEVSSSAEQLRQRYPGNSTQIQRQQEELSQRWGQLEALKREKAVQLAHSV
EVCSFLQECGPTQVQLRDVLLQLEALQPGSSEDTCHALQLAQKKTLVLER
RVHFLQSVVVKVEEPGYAESQPLQGQVETLQGLLKQVQEQVAQRARRQAE
TQARQSFLQESQQLLLWAESVQAQLRSKEVSVDVASAQRLLREHQDLLEE
IHLWQERLQQLDAQSQPMAALDCPDSQEVPNTLRVLGQQGQELKVLWEQR
QQWLQEGLELQKFGREVDGFTATCANHQAWLHLDNLGEDVREALSLLQQH
REFGRLLSTLGPRAEALRAHGEKLVQSQHPAAHTVREQLQSIQAQWTRLQ
GRSEQRRRQLLASLQLQEWKQDVAELMQWMEEKGLMAAHEPSGARRNILQ
TLKRHEAAESELLATRRHVEALQQVGRELLSRRPCGQEDIQTRLQGLRSK
WEALNRKMTERGDELQQAGQQEQLLRQLQDAKEQLEQLEGALQSSETGQD
LRSSQRLQKRHQQLESESRTLAAKMAALASMAHGMAASPAILEETQKHLR
RLELLQGHLAIRGLQLQASVELHQFCHLSNMELSWVAEHMPHGSPTSYTE
CLNGAQSLHRKHKELQVEVKAHQGQVQRVLSSGRSLAASGHPQAQHIVEQ
CQELEGHWAELERACEARAQCLQQAVTFQQYFLDVSELEGWVEEKRPLVS
SRDYGRDEAATLRLINKHQALQEELAIYWSSMEELDQTAQTLTGPEVPEQ
QRVVQERLREQLRALQELAATRDRELEGTLRLHEFLREAEDLQGWLASQK
QAAKGGESLGEDPEHALHLCTKFAKFQHQVEMGSQRVAACRLLAESLLER
GHSAGPMVRQRQQDLQTAWSELWELTQARGHALRDTETTLRVHRDLLEVL
TQVQEKATSLPNNVARDLCGLEAQLRSHQGLERELVGTERQLQELLETAG
RVQKLCPGPQAHAVQQRQQAVTQAWAVLQRRMEQRRAQLERARLLARFRT
AVRDYASWAARVRQDLQVEESSQEPSSGPLKLSAHQWLRAELEAREKLWQ
QATQLGQQALLAAGTPTKEVQEELRALQDQRDQVYQTWARKQERLQAEQQ
EQLFLRECGRLEEILAAQEVSLKTSALGSSVEEVEQLIRKHEVFLKVLTA
QDKKEAALRERLKTLRRPRVRDRLPILLQRRMRVKELAESRGHALHASLL
MASFTQAATQAEDWIQAWAQQLKEPVPPGDLRDKLKPLLKHQAFEAEVQA
HEEVMTSVAKKGEALLAQSHPRAGEVSQRLQGLRKHWEDLRQAMALRGQE
LEDRRNFLEFLQRVDLAEAWIQEKEVKMNVGDLGQDLEHCLQLRRRLREF
RGNSAGDTVGDACIRSISDLSLQLKNRDPEEVKIICQRRSQLNNRWASFH
GNLLRYQQQLEGALEIHVLSRELDNVTKRIQEKEALIQALDCGKDLESVQ
RLLRKHEELEREVHPIQAQVESLEREVGRLCQRSPEAAHGLRHRQQEVAE
SWWQLRSRAQKRREALDALHQAQKLQAMLQELLVSAQRLRAQMDTSPAPR
SPVEARRMLEEHQECKAELDSWTDSISLARSTGQQLLTAGHPFSSDIRQV
LAGLEQELSSLEGAWQEHQLQLQQALELQLFLSSVEKMERWLCSKEDSLA
SEGLWDPLAPMEPLLWKHKMLEWDLEVQAGKISALEATARGLHQGGHPEA
QSALGRCQAMLLRKEALFRQAGTRRHRLEELRQLQAFLQDSQEVAAWLRE
KNLVALEEGLLDTAMLPAQLQKQQNFQAELDASMHQQQELQREGQRLLQG
GHPASEAIQERLEELGALWGELQDNSQKKVAKLQKACEALRLRRSMEELE
NWLEPIEVELRAPTVGQALPGVGELLGTQRELEAAVDKKARQAEALLGQA
QAFVREGHCLAQDVEEQARRLLQRFKSLREPLQERRTALEARSLLLKFFR
DADEEMAWVQEKLPLAAAQDYGQSLSAVRHLQEQHQNLESEMSSHEALTR
VVLGTGYKLVQAGHFAAHEVAARVQQLEKAMAHLRAEAARRRLLLQQAQE
AQQFLTELLEAGSWLAERGHVLDSEDMGHSAEATQALLRRLEATKRDLEA
FSPRIERLQQTAALLESRKNPESPKVLAQLQAVREAHAELLRRAEARGHG
LQEQLQLHQLERETLLLDAWLTTKAATAESQDYGQDLEGVKVLEEKFDAF
RKEVQSLGQAKVYALRKLAGTLERGAPRRYPHIQAQRSRIEAAWERLDQA
IKARTENLAAAHEVHSFQQAAAELQGRMQEKTALMKGEDGGHSLSSVRTL
QQQHRRLERELEAMEKEVARLQTEACRLGQLHPAAPGGLAKVQEAWATLQ
AKAQERGQWLAQAAQGHAFLGRCQELLAWAQERQELASSEELAEDVAGAE
QLLGQHEELGQEIRECRLQAQDLRQEGQQLVDNSHFMSAEVTECLQELEG
RLQELEEAWALRWQRCAESWGLQKLRQRLEQAEAWLACWEGLLLKPDYGH
SVSDVELLLHRHQDLEKLLAAQEEKFAQMQKTEMEQELLLQPQELKPGRA
GSSLTSFQWRPSGHQGLGAQLAETRDPQDAKGTPTMEGSLEFKQHLLPGG
RQPSSSSWDSCRGNLQGSSLSLFLDERMAAEKVASIALLDLTGARCERLR
GRHGRKHTFSLRLTSGAEILFAAPSEEQAESWWRALGSTAAQSLSPKLKA
KPVSSLNECTTKDARPGCLLRSDP

Кодований геном білок за функцією належить до кепінгів актину. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Stabach P.R., Morrow J.S. (2000). Identification and characterization of beta V spectrin, a mammalian ortholog of Drosophila beta H spectrin.. J. Biol. Chem. 275: 21385 — 21395.  PubMed DOI:10.1074/jbc.C000159200
  • Odell A.F., Van Helden D.F., Scott J.L. (2008). The spectrin cytoskeleton influences the surface expression and activation of human transient receptor potential channel 4 channels.. J. Biol. Chem. 283: 4395 — 4407.  PubMed DOI:10.1074/jbc.M709729200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:15680 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9NRC6 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]